DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and MTF-1

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001097560.1 Gene:MTF-1 FlyBaseID:FBgn0040305 Length:1006 Species:Drosophila melanogaster

Alignment Length:320 Identity:75/321 (23%)
Similarity:134/321 (42%) Gaps:59/321 (18%)


  Fly   317 NMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVV 381
            |...:..::.||      :..:....::|||     .|....:.|:.....::...:|:|     
  Fly   235 NEAANPPINCDN------DQGTGNSISRDST-----SNSPAYFTIETSYVDEYDPNEPDE----- 283

  Fly   382 VFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTV 446
                .|:::...|....|::|...|.|:.|.::|.         :....|||         .:.:
  Fly   284 ----DEQLAHCIQPGVLHQDVDEEEVERQDENDQL---------MALAYESS---------DEAL 326

  Fly   447 KSFQCHL--CPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCP--SCALQLSCASSLKRHMIIHTG 507
            ..::|:.  |..::.|...|..|..||....      :.|||  .|......:.|||.|:.:||.
  Fly   327 SRYRCNYENCYRSYSTIGNLRTHLKTHTGDY------SFKCPEDGCHKAFLTSYSLKIHVRVHTK 385

  Fly   508 LKPFKC--SECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHK 570
            :||::|  |.|:.:|:.|..|..|:..|.| :...|..|..||...|:|::|: |.|. ..|.:|
  Fly   386 VKPYECEVSGCDKAFNTRYRLHAHLRLHNG-ETFNCELCQKCFTTLSDLKKHM-RTHT-QERPYK 447

  Fly   571 C--HLCHRSFNHVSGLSRHLVTHAGVM-FSCKQ--CGRQFNDRSAVQRHVTT-MHKVKNK 624
            |  ..|.::|.....|..|..||.|.. :.|::  |.:.|:...:::.|..| ..:::||
  Fly   448 CPEDDCGKAFTASHHLKTHRRTHTGEKPYPCQEDSCQKSFSTSHSLKSHKKTHQRQLQNK 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 25/80 (31%)
C2H2 Zn finger 485..505 CDD:275368 7/22 (32%)
zf-H2C2_2 497..522 CDD:290200 12/27 (44%)
C2H2 Zn finger 513..533 CDD:275368 7/22 (32%)
zf-H2C2_2 526..550 CDD:290200 8/24 (33%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 6/22 (27%)
C2H2 Zn finger 598..617 CDD:275368 4/21 (19%)
MTF-1NP_001097560.1 zf-C2H2_aberr 329..471 CDD:293622 46/151 (30%)
C2H2 Zn finger 331..353 CDD:275368 6/22 (27%)
zf-H2C2_2 345..372 CDD:290200 8/33 (24%)
C2H2 Zn finger 361..383 CDD:275368 7/22 (32%)
zf-H2C2_2 375..402 CDD:290200 12/27 (44%)
C2H2 Zn finger 391..413 CDD:275368 7/22 (32%)
zf-C2H2 418..440 CDD:278523 8/23 (35%)
C2H2 Zn finger 420..440 CDD:275368 8/21 (38%)
zf-H2C2_2 432..458 CDD:290200 9/28 (32%)
COG5048 442..>519 CDD:227381 17/67 (25%)
C2H2 Zn finger 448..470 CDD:275368 6/22 (27%)
zf-H2C2_2 462..489 CDD:290200 8/27 (30%)
C2H2 Zn finger 478..500 CDD:275368 5/22 (23%)
DUF3682 862..>931 CDD:289231
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24377
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.