DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zbtb42

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001093930.1 Gene:Zbtb42 MGIID:3644133 Length:420 Species:Mus musculus

Alignment Length:254 Identity:62/255 (24%)
Similarity:94/255 (37%) Gaps:61/255 (24%)


  Fly   351 DQDNGITSYNIKEDGEIQFSGEKPEEIEDV--VVFNLGEEISQEQQVFSFHENVIIVEKEQ---N 410
            :|.:|....::|       ...:||::...  :..:|...:.|..|.        :|:.||   :
Mouse   181 EQSSGALDLSLK-------PSPRPEQVHPPCRLQTSLCSSVQQVAQP--------LVKAEQDSFS 230

  Fly   411 DRDEQTPLKRKRSSELVFKQESSCPQPKTGRITD--------------------TVKSFQ----- 450
            ::|..:|....||...|      |.....|...|                    .:.|.:     
Mouse   231 EQDSSSPQSADRSPPPV------CASAAQGLAVDLEPLHIEGTGSQQLGLPAEPVLDSEELGPSR 289

  Fly   451 ----CHLCPVAFPTQKLLTRHHNTH------IKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIH 505
                |.||...||:...|..|.:.|      ::...|.:|....||.|:...||..:||||...|
Mouse   290 HLCICPLCCKLFPSTHALQLHLSAHFRERDSVRARLSPEGSVPTCPLCSKTFSCTYTLKRHERTH 354

  Fly   506 TGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMG 564
            :|.||:.|.:|..||.....|.||...||..|.|.|..|...|.|..:|.:|:.:.|.|
Mouse   355 SGEKPYTCVQCGKSFQYSHNLSRHAVVHTREKPHACRWCERRFTQSGDLYRHVRKFHYG 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 28/82 (34%)
C2H2 Zn finger 485..505 CDD:275368 9/20 (45%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
Zbtb42NP_001093930.1 BTB 14..114 CDD:279045
BTB 25..121 CDD:197585
C2H2 Zn finger 294..314 CDD:275368 7/20 (35%)
COG5048 334..>388 CDD:227381 23/54 (43%)
C2H2 Zn finger 334..354 CDD:275368 9/20 (45%)
zf-H2C2_2 347..369 CDD:290200 11/22 (50%)
C2H2 Zn finger 362..382 CDD:275368 7/20 (35%)
C2H2 Zn finger 390..408 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.