DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and pita

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster

Alignment Length:617 Identity:143/618 (23%)
Similarity:231/618 (37%) Gaps:202/618 (33%)


  Fly    13 LCRLCLKEHQDAYAIFDED---DTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEKSFLFR 74
            :||.||.| |...:||:|:   .|..::|:::||..|::..|.|.:|..||.|||...|..:.|:
  Fly    17 VCRFCLTE-QKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCYRFK 80

  Fly    75 QRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWREDF 139
            |.|:.||..||:: .|.|                                         .|....
  Fly    81 QMCKRAETLLRQY-PLTG-----------------------------------------NWPSPL 103

  Fly   140 KEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEV---RSQVRDDLRNEVSED 201
             |:..|.|.....|..|.:.|| |.|         .||..|:|...:   .|||       :.||
  Fly   104 -EKPRAPMTMVASKKLLVVPAK-TAE---------PSETPKKLLNTMAKSSSQV-------IIED 150

  Fly   202 IRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANL 266
            ::..:.||:                          .|:....:||       :|:|.        
  Fly   151 VQVLESAMV--------------------------TPRTVAGSSP-------VPRRS-------- 174

  Fly   267 KATEARKDAKEEEFILGCNTDPANNSDVNIDGLE-LDEEVPAESGEDFREINMVGSDVVHTDNGE 330
            .|.|.:.|               ||.::::|.:: :.|::.:|..::|.:|....|.|      :
  Fly   175 HAYELKVD---------------NNQELSMDDVQSMLEDMASELEKEFPDIPQKASPV------K 218

  Fly   331 IYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQV 395
            ..::|.:|....|:.  |....:..:.:..:|.|.    ||                        
  Fly   219 PKVLNKSSIRILNKG--PAAPVEPRLATPKVKRDD----SG------------------------ 253

  Fly   396 FSFHENVIIV------EKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLC 454
                 ||.||      :...:|:|:.|     :::|.|              .||.   |.|..|
  Fly   254 -----NVAIVTEVLDSDLPLDDQDDPT-----KNAEKV--------------ATDV---FPCPDC 291

  Fly   455 PVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELS 519
            ..:||.|:||..|...|.      :..:.:|..|.........|.:|..:|||.:||||:.|..:
  Fly   292 ERSFPLQQLLEIHRLNHT------RSRSFQCLLCEKSFFSKYDLAKHNFVHTGERPFKCAICSKA 350

  Fly   520 FSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGL 584
            |:::.:|.||..|||.|.:..|..|...|..:..:::|..| |. ..|..:|.:|.:||....||
  Fly   351 FTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAER-HQ-KKRPFQCGVCTKSFAFKQGL 413

  Fly   585 SRHLVTHA-GVMFSCKQCGRQFNDRSAVQRHV 615
            .||...|: .:.|.|:.|.|.|:..|.:.||:
  Fly   414 ERHETVHSTNLPFPCQHCERSFSTASKLARHL 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 30/76 (39%)
vATP-synt_E 109..>244 CDD:304907 22/138 (16%)
RRF <161..222 CDD:294170 14/64 (22%)
zf-C2H2_8 454..530 CDD:292531 24/76 (32%)
C2H2 Zn finger 485..505 CDD:275368 4/20 (20%)
zf-H2C2_2 497..522 CDD:290200 11/25 (44%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 5/21 (24%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 7/19 (37%)
pitaNP_611806.3 zf-AD 17..92 CDD:214871 30/76 (39%)
COG5048 <281..506 CDD:227381 57/191 (30%)
C2H2 Zn finger 288..308 CDD:275368 8/20 (40%)
C2H2 Zn finger 316..336 CDD:275368 4/20 (20%)
zf-H2C2_2 328..353 CDD:290200 11/25 (44%)
C2H2 Zn finger 344..364 CDD:275368 7/20 (35%)
C2H2 Zn finger 372..388 CDD:275370 3/16 (19%)
C2H2 Zn finger 400..420 CDD:275368 8/20 (40%)
C2H2 Zn finger 428..448 CDD:275368 7/19 (37%)
C2H2 Zn finger 456..476 CDD:275368
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86894094
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.980

Return to query results.
Submit another query.