DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and CG10321

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001261124.1 Gene:CG10321 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster

Alignment Length:828 Identity:157/829 (19%)
Similarity:308/829 (37%) Gaps:265/829 (32%)


  Fly     9 DLATLCRLCLKEHQDAYAIFDEDDTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEKSFLF 73
            :|..:||||:.|.::...:|.|     .:|..||.|.::..:.|:..|.:||.:|.:.:.::..|
  Fly     8 ELDKICRLCISERKEMRPLFSE-----KVPEMLMDCTSVRVEPTEGWPDKICVQCVHAVSRNHAF 67

  Fly    74 RQRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQ---------DKVRK 129
            :...:.::|:||::||.|.:..           ..|::.:.|.:.|..::|         .|.:|
  Fly    68 KTLVERSDKELREYIRGLTVAL-----------VMEEQQQQEAANAKQQLQLERKQQRQLQKQQK 121

  Fly   130 LEDEKWREDFKEEQAAEMHKRLVKSRLE--LRAKLTTELRKEL------------AEEVRSEVRK 180
            :.:|:.::...::|   .|:...|.:|:  ||.....:.::.|            |.:.:.::.:
  Fly   122 ILEEQLQQQIVQQQ---QHQPPAKPKLKPLLRKGSRQQKQRHLEAAPAPQSVPQPAPQPQMQLMQ 183

  Fly   181 ELAEE---VRSQVRD---------------------DLRNEV---------SEDIRKEQLAMLLG 212
            |.|.:   ::.|::.                     .:..::         :..|...|||.::.
  Fly   184 EHAPQQPTMQQQIQQIHMPTLQPAPAQLLSAAGATTTMPQQILLPNGQLITTAQIVAPQLAQIIS 248

  Fly   213 ELEVYLTEKKAGRWESLDGSEPETKPQVKEDAS---------PSRSKT----KALPKRR------ 258
            ......|..:|      ..::.:..||:.:..:         |:.::|    :.:|:|.      
  Fly   249 TAPQSTTNGQA------TAAQSQFLPQLLQTPNGQTLQIVQQPNGTQTLQLVQLVPQRSLAPTGV 307

  Fly   259 -----------------PSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVP 306
                             .||.||:::..|...:.::|| :........:.:|.:.:.:.||::..
  Fly   308 TTVTTTTNATDMGQHVGASLGDADVQLLEDGCEVEDEE-LEDVYEQLDSKADHSFETIVLDDDQQ 371

  Fly   307 AESGEDFREIN--MVGSDVVHTDNGEIYIINSASS-------EDQNQDSTPEFDQDNGITSYNIK 362
            .:..:|..|.:  |:..|:..:::.:....:....       ||:.:...||.|||..|......
  Fly   372 QDFLKDHHEHHQVMINEDLTQSESQDHEYFDDLDQQQAMDEIEDEEEQMKPEEDQDTFIIEEIQL 436

  Fly   363 EDGEI-------------QFSGEKPE-----EIEDVVVFNL-----GEEISQEQQVFSFHENVII 404
            ||.|:             ::.||:.:     :::|.:.:::     ||......|.|        
  Fly   437 EDDEMLDDPDGEEIDQDCEYIGEEQDPHLSGDVDDDLEYSIMEPPDGETSVDIDQAF-------- 493

  Fly   405 VEKEQNDRDEQTPLKRKRSSE---LVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTR 466
            ::.||:...:.....:..|.|   :.|.|.::..:...|. |.||.|        |.||.|...|
  Fly   494 MDSEQSHHQQHQEEMQSISLENAVVEFSQATTTTEALVGP-TMTVSS--------ASPTPKRAKR 549

  Fly   467 HHNTHIKGLKSGKGGTLK-C---PSCA-----LQLSCASSLKRHMI------------------- 503
            .::      :...|.||: |   |..|     .:|:.|:|  |.::                   
  Fly   550 SNH------QIPAGVTLEPCDHQPPAAGSTTSSKLAAANS--RQLVQTASVIAAAGADDNYEIDA 606

  Fly   504 --------IHT---GLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQC---PQCSSC---FAQK 551
                    .||   |...:.|..|...|.|.:.|:.||.:||...|..|   |||..|   |...
  Fly   607 NLVTEFIRQHTSPLGSGRYICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQPQCQICLKSFKGP 671

  Fly   552 SNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTH------AGV---------------- 594
            ..|:.|: :.|...|.|..|.:|:|:|...:.|.||..||      .||                
  Fly   672 GMLRMHM-KTHDAESSTPMCTICNRTFKSKAILYRHRQTHQQRAYCCGVANCRKNFSSAVNLKWH 735

  Fly   595 -----------MFSCKQCGRQFNDRSAVQRHVTTMHKVKNKLTDYISE 631
                       :|.|.:||..:::..::|.||.:        ||:.:|
  Fly   736 VERKHPEVVDPLFKCGECGSLYDNVDSLQLHVES--------TDHSAE 775

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 20/73 (27%)
vATP-synt_E 109..>244 CDD:304907 26/191 (14%)
RRF <161..222 CDD:294170 10/106 (9%)
zf-C2H2_8 454..530 CDD:292531 24/115 (21%)
C2H2 Zn finger 485..505 CDD:275368 7/55 (13%)
zf-H2C2_2 497..522 CDD:290200 8/55 (15%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 12/30 (40%)
C2H2 Zn finger 541..562 CDD:275368 8/27 (30%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871 20/73 (27%)
ASF1_hist_chap <405..516 CDD:304562 22/119 (18%)
C2H2 Zn finger 627..647 CDD:275368 7/20 (35%)
C2H2 Zn finger 661..681 CDD:275368 5/21 (24%)
C2H2 Zn finger 690..710 CDD:275368 8/20 (40%)
C2H2 Zn finger 717..740 CDD:275368 2/23 (9%)
C2H2 Zn finger 750..767 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.