DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zkscan7

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_017451264.1 Gene:Zkscan7 RGDID:1305242 Length:1169 Species:Rattus norvegicus

Alignment Length:505 Identity:126/506 (25%)
Similarity:182/506 (36%) Gaps:155/506 (31%)


  Fly   199 SEDIRKEQLAMLLG-------ELEVYLTEKKAGRWESLDGSE--PETKPQVKEDASPSRSKTKAL 254
            |.||.::.||.:.|       |||....||...:..:.|..|  .:.:.:.:..:||:..:.:| 
  Rat   453 SGDICEDPLAQVEGCPSDEGSELESDFLEKNDEKNSTKDRIEDSKDVRERPESPSSPAEHQREA- 516

  Fly   255 PKRRPSLVDANLKATEARKDAKEEEFILG------------CNTDPANNSDVNIDGLELDEEVPA 307
             ||:.|     .:..|..|.......:||            ||                      
  Rat   517 -KRQNS-----YQCDECGKIFNRSSHLLGHRRIHTGERPSECN---------------------- 553

  Fly   308 ESGEDFREINMVGSDVVH------------TDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYN 360
            |.|:.|.:.:.:   :||            .::|:.|..:|...:.|...:..:..:.|.....:
  Rat   554 ECGKTFLQTSQL---IVHLRTHTQEKPYECQESGKTYCHSSRLIQHQRLHNGEKPYKGNECVKAS 615

  Fly   361 IKEDGEIQFSG----EKPEEIEDVVVFNLGEEISQEQQVF--------------SFHENVIIVEK 407
            |:....|...|    |||.|.|:..:::.    |.:.||.              :|..|      
  Rat   616 IQSSQLIDHKGAHAAEKPNESEEAFIWSK----SLQHQVLHTSKKPYECNECGKAFCSN------ 670

  Fly   408 EQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHI 472
             :|..|.|                         ||....|.::|..|..||...|.||||.:.| 
  Rat   671 -RNLTDHQ-------------------------RIHTGEKPYECIECGKAFSRSKCLTRHQSLH- 708

  Fly   473 KGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVK 537
            .|.|     ..||..|....|..|.|..|..||||.|||:||||...||..:.|.||...|||.|
  Rat   709 TGEK-----PYKCSECGKAFSQNSQLIDHERIHTGEKPFECSECGKKFSLSKCLIRHQRLHTGEK 768

  Fly   538 RHQCPQCSSCFAQKSNLQQHIGRVHMG---------------------NSRTH------KCHLCH 575
            .::|.:|...|.|.|:|..| .|:|.|                     :.|||      ||..|.
  Rat   769 PYKCSECGKSFNQNSHLIIH-QRIHTGEKPYGCNECGKVFSYSSSLMVHQRTHTGEKPYKCKDCM 832

  Fly   576 RSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMHKVKNK 624
            :||...|.|..|...|.|.. :.|.:||:.|:.||....|..| |.|:.:
  Rat   833 KSFGDSSQLIVHQRVHTGEKPYECIECGKAFSQRSTFNHHQRT-HNVEKQ 881

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 13/54 (24%)
RRF <161..222 CDD:294170 11/30 (37%)
zf-C2H2_8 454..530 CDD:292531 34/76 (45%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 15/25 (60%)
C2H2 Zn finger 513..533 CDD:275368 9/20 (45%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 7/19 (37%)
Zkscan7XP_017451264.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.