DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zbtb48

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001013234.2 Gene:Zbtb48 RGDID:1311581 Length:683 Species:Rattus norvegicus

Alignment Length:432 Identity:105/433 (24%)
Similarity:156/433 (36%) Gaps:146/433 (34%)


  Fly   300 ELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKE- 363
            :||||      |.||.:::...|....|.            :|.|.|||. ..........:|: 
  Rat   144 DLDEE------EVFRTLSLASVDQEPRDG------------EQPQLSTPA-QSSPAFLCGKLKQV 189

  Fly   364 -------DGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRD-------E 414
                   |.|.:.|.|.|...|.......||  |.|.:|      |:.||   :|||       |
  Rat   190 LKPSPPADKESEDSKEPPRPFEAEGAPLQGE--SNEWEV------VVQVE---DDRDGDGDYASE 243

  Fly   415 QTPLKRKRSSELVFKQESSCPQPKTGRIT-DTVKSFQCHLCPVAFPT--QKLLTRH----HNTHI 472
            ...:..:|.|:::.|..::.|....|.:| :..:..:....||..||  :|.|:::    ||...
  Rat   244 PETVLTRRKSKVIRKPCAAEPALGAGSLTAEPTEGRKGAAVPVECPTCHKKFLSKYYLKVHNRKH 308

  Fly   473 KGLKSGKGGTLKCPSC-----------------ALQLS--------CASSLKR------HMIIHT 506
            .|.|     ..:||.|                 .:..|        |..:.:|      ||:.||
  Rat   309 TGEK-----PFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRMELRVHMVSHT 368

  Fly   507 GLKPFKCSECELSFSQREVLKRHM-DTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNS---- 566
            |..|:|||.|...|.|::.|:.|| ..|...|.|.||.|:.||..::.||.|....|.|..    
  Rat   369 GEMPYKCSSCSQQFMQKKDLQSHMIKLHGAPKPHACPTCAKCFLSRTELQLHEAFKHRGEKLFVC 433

  Fly   567 ----------------------------------------------RTH------KCHLCHRSFN 579
                                                          |||      :||||.::|.
  Rat   434 EECGHRASSRNGLQMHIKAKHRNERPYVCEFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFR 498

  Fly   580 HVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMHK 620
            ..:.|.:|..||.|.. |||:.|.::|.::..:.|||.:.|:
  Rat   499 TQASLDKHNRTHTGERPFSCEFCEQRFTEKGPLLRHVASRHQ 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 30/113 (27%)
C2H2 Zn finger 485..505 CDD:275368 8/51 (16%)
zf-H2C2_2 497..522 CDD:290200 12/31 (39%)
C2H2 Zn finger 513..533 CDD:275368 8/21 (38%)
zf-H2C2_2 526..550 CDD:290200 11/25 (44%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
Zbtb48NP_001013234.2 BTB 16..114 CDD:279045
BTB 27..119 CDD:197585
C2H2 Zn finger 288..308 CDD:275368 6/20 (30%)
zf-H2C2_2 300..323 CDD:290200 7/28 (25%)
C2H2 Zn finger 316..367 CDD:275368 8/51 (16%)
zf-H2C2_2 359..382 CDD:290200 10/23 (43%)
C2H2 Zn finger 375..396 CDD:275368 8/21 (38%)
C2H2 Zn finger 404..420 CDD:275370 7/16 (44%)
C2H2 Zn finger 433..454 CDD:275368 0/21 (0%)
COG5048 458..>519 CDD:227381 16/61 (26%)
C2H2 Zn finger 462..482 CDD:275368 2/20 (10%)
zf-H2C2_2 474..499 CDD:290200 8/25 (32%)
C2H2 Zn finger 490..510 CDD:275368 8/20 (40%)
zf-H2C2_2 502..526 CDD:290200 10/24 (42%)
C2H2 Zn finger 518..535 CDD:275368 5/17 (29%)
C2H2 Zn finger 550..567 CDD:275368
zf-H2C2_2 560..584 CDD:290200
zf-C2H2 573..595 CDD:278523
C2H2 Zn finger 575..595 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.