DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and hic2

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_878289.2 Gene:hic2 ZFINID:ZDB-GENE-030619-1 Length:560 Species:Danio rerio

Alignment Length:477 Identity:109/478 (23%)
Similarity:171/478 (36%) Gaps:135/478 (28%)


  Fly   218 LTEKKAGRWESLDGSEPETKPQVKEDASPSR----SKTKALPKRRPSLVDA--NLKATEARKDAK 276
            |..||..|    :|.....||....:...||    |.|...|.:...|.|:  ..:..|..||..
Zfish   112 LCRKKLKR----NGRSLLNKPTTPTNGRTSRNQRLSSTPVTPNQMSGLKDSEKTKRHEELIKDDL 172

  Fly   277 EEEFILGCNT--------DPA-----NNSDVNIDGLELD------------EEV-----PAESGE 311
            .|:.:...||        .|:     :|....:..|.||            |||     |.||.:
Zfish   173 SEDEMFARNTHCTTSNSLSPSTSKNGSNGSCGMQELGLDLSKKSPSGSTATEEVSPSSIPQESPQ 237

  Fly   312 DFREINMVGSDVVHTDNGEIYIINSASSED----QN--------------QDSTPEFDQDNGITS 358
            ...|..                .||||.::    ||              ::|.|..|.|...:|
Zfish   238 SASEST----------------ANSASFDENPNTQNLTAGEPMELGVGECEESQPPPDVDQHKSS 286

  Fly   359 YNI-KEDGEIQFSGEKPEEIEDVVVFN--------LGEEI---SQEQQVFSF----HENVIIVEK 407
            ..: ::..:.:..|:|.|::|.|.:.|        .||.:   .......||    .|..:...:
Zfish   287 RQVTRQRRQPKSEGKKGEDMERVTLPNGVSKRLKVAGERLPAGGNGNSEVSFQCKDEEEGLENGQ 351

  Fly   408 EQNDRDEQTPLKRKR-SSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTH 471
            ||::...|:..:..| |:..|::||..  :|..|   |.:  :.|..|...||:.:.|..|..||
Zfish   352 EQSEESGQSENEGGRNSANYVYRQEGF--EPALG---DNL--YVCIPCGKGFPSSEELNAHVETH 409

  Fly   472 --------------------------------IKGLKSGKGGTLKCPSCALQLSCASSLKRHMII 504
                                            :.|.::.:   ..|..|.......::|::|...
Zfish   410 TEEELYIKEEDNDSYPKEDEVEAEDLSSQITQVHGTETRR---FSCSVCNKSYKDPATLRQHEKT 471

  Fly   505 HTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTH 569
            |...:||.|:.|...|:||..:.|||.:|.|:|...|.:|...|.::..|.:|: |||.| .:.:
Zfish   472 HWLTRPFPCNICGKMFTQRGTMTRHMRSHLGLKPFACEECGMRFTRQYRLTEHM-RVHSG-EKPY 534

  Fly   570 KCHLCHRSFNHVSGLSRHLVTH 591
            :|.||...|.....|..||..|
Zfish   535 ECQLCGGKFTQQRNLISHLRMH 556

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 7/26 (27%)
RRF <161..222 CDD:294170 2/4 (50%)
zf-C2H2_8 454..530 CDD:292531 22/108 (20%)
C2H2 Zn finger 485..505 CDD:275368 4/20 (20%)
zf-H2C2_2 497..522 CDD:290200 8/25 (32%)
C2H2 Zn finger 513..533 CDD:275368 8/20 (40%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368
hic2NP_878289.2 BTB 18..118 CDD:279045 3/6 (50%)
BTB 25..120 CDD:197585 4/12 (33%)
C2H2 Zn finger 389..409 CDD:275368 7/20 (35%)
zf-C2H2 450..472 CDD:278523 4/22 (18%)
C2H2 Zn finger 452..472 CDD:275368 4/20 (20%)
zf-C2H2 478..500 CDD:278523 9/22 (41%)
C2H2 Zn finger 480..500 CDD:275368 8/20 (40%)
zf-H2C2_2 493..517 CDD:290200 9/24 (38%)
C2H2 Zn finger 508..528 CDD:275368 7/21 (33%)
zf-H2C2_2 521..545 CDD:290200 10/26 (38%)
C2H2 Zn finger 536..556 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.