DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and CG17328

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster

Alignment Length:627 Identity:108/628 (17%)
Similarity:169/628 (27%) Gaps:334/628 (53%)


  Fly    13 LCRLCLKEHQDAYAIFDEDDTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEKSFLFRQRC 77
            :||:||:|.....:|:..|...:. .|.||.|..:....||.||..||..|.|:|..:|.|:|.|
  Fly     8 ICRVCLEELHPVTSIYSTDFAMMP-SVMLMQCAKIRVFKTDGLPSVICNNCIYRLGVAFHFKQEC 71

  Fly    78 QWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWREDFKEE 142
            :.::.:||:::.:|                                         |.||:|    
  Fly    72 ENSDLRLRQYLGIL-----------------------------------------ESWRQD---- 91

  Fly   143 QAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQL 207
                             |...|:.           |.|.|                         
  Fly    92 -----------------AATNTDF-----------VEKPL------------------------- 103

  Fly   208 AMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEAR 272
                                                          ||:|               
  Fly   104 ----------------------------------------------LPQR--------------- 107

  Fly   273 KDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSA 337
                                       :.|||.|.::....|                       
  Fly   108 ---------------------------DSDEEEPVDAKVSKR----------------------- 122

  Fly   338 SSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENV 402
                                        ..::..:.|||                          
  Fly   123 ----------------------------RSRYQRKPPEE-------------------------- 133

  Fly   403 IIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRH 467
                            .:||..:.|.|...:|              ::||               
  Fly   134 ----------------HKKRGPKPVPKMPHTC--------------YECH--------------- 153

  Fly   468 HNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDT 532
                    ||.|              |.:.|.:|:..|||.||::||.|...|:|:..||.|..|
  Fly   154 --------KSFK--------------CIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERT 196

  Fly   533 HTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-F 596
            |||.|..||..||..|:...|.|.| .::|:| .|...|.||.:.|.....||:|::||.|:. .
  Fly   197 HTGDKPFQCEICSKQFSALGNFQAH-QKIHLG-VRDQVCSLCQKGFYTAGDLSKHMITHTGIKNH 259

  Fly   597 SCKQCGRQFNDRSAVQRHVTTMHKVKNKLTDYISETNEFQAV 638
            .|..||:.|:.|..::.|...:|.:::.....|.:.::.:|:
  Fly   260 HCDVCGKAFSRRRDMRTHKLKLHPLESSTNHDIVDDDDDEAI 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 26/73 (36%)
vATP-synt_E 109..>244 CDD:304907 9/135 (7%)
RRF <161..222 CDD:294170 4/61 (7%)
zf-C2H2_8 454..530 CDD:292531 19/76 (25%)
C2H2 Zn finger 485..505 CDD:275368 3/20 (15%)
zf-H2C2_2 497..522 CDD:290200 11/25 (44%)
C2H2 Zn finger 513..533 CDD:275368 9/20 (45%)
zf-H2C2_2 526..550 CDD:290200 13/24 (54%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 26/73 (36%)
COG5048 146..>211 CDD:227381 31/116 (27%)
C2H2 Zn finger 149..169 CDD:275368 9/71 (13%)
zf-H2C2_2 162..186 CDD:290200 11/24 (46%)
C2H2 Zn finger 177..197 CDD:275368 9/20 (45%)
zf-H2C2_2 189..213 CDD:290200 13/24 (54%)
C2H2 Zn finger 205..225 CDD:275368 7/21 (33%)
C2H2 Zn finger 233..253 CDD:275368 8/20 (40%)
zf-H2C2_2 245..270 CDD:290200 10/25 (40%)
C2H2 Zn finger 261..282 CDD:275368 6/21 (29%)
C2H2 Zn finger 318..338 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86893027
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.980

Return to query results.
Submit another query.