DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and ZNF879

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001129588.1 Gene:ZNF879 HGNCID:37273 Length:563 Species:Homo sapiens

Alignment Length:297 Identity:90/298 (30%)
Similarity:133/298 (45%) Gaps:43/298 (14%)


  Fly   329 GEIYIINSASSEDQN----------QDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVF 383
            |:|::.:|:.|:.|.          ::....|.|.:.:|.:....      :||||     .:..
Human   210 GKIFLHSSSLSKHQRIHTGEKLYKCKECRKAFSQSSSLTQHLRVH------TGEKP-----YICS 263

  Fly   384 NLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKS 448
            ..|       :.|||..::|   ..|.....:.|.|.|...: .||..||....:  ||....|.
Human   264 ECG-------KAFSFTTSLI---GHQRMHTGERPYKCKECGK-TFKGSSSLNNHQ--RIHTGEKP 315

  Fly   449 FQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKC 513
            ::|:.|..||.....|.:||..| .|.|     ..:|..|....:..|.|.||..||||.|||.|
Human   316 YKCNECGRAFSQCSSLIQHHRIH-TGEK-----PYECTQCGKAFTSISRLSRHHRIHTGEKPFHC 374

  Fly   514 SECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSF 578
            :||...||....|..|...|||.|.:.|.:|...|:|.|.|.|| .|:|.| .:.:||:.|.::|
Human   375 NECGKVFSYHSALIIHQRIHTGEKPYACKECGKAFSQSSALIQH-QRIHTG-EKPYKCNECGKAF 437

  Fly   579 NHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRH 614
            :.:|.|:.|...|.|.. ::||:||:.|:..|.|..|
Human   438 SWISRLNIHHRIHTGEKPYNCKECGKAFSSHSGVNTH 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 29/76 (38%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 15/25 (60%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 9/21 (43%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 8/18 (44%)
ZNF879NP_001129588.1 KRAB 14..74 CDD:214630
COG5048 202..558 CDD:227381 90/298 (30%)
C2H2 Zn finger 206..226 CDD:275368 5/16 (31%)
C2H2 Zn finger 234..254 CDD:275368 3/20 (15%)
C2H2 Zn finger 262..282 CDD:275368 6/30 (20%)
C2H2 Zn finger 290..310 CDD:275368 7/23 (30%)
C2H2 Zn finger 318..338 CDD:275368 7/20 (35%)
C2H2 Zn finger 346..366 CDD:275368 7/20 (35%)
C2H2 Zn finger 374..394 CDD:275368 7/20 (35%)
C2H2 Zn finger 402..422 CDD:275368 9/21 (43%)
C2H2 Zn finger 430..450 CDD:275368 6/20 (30%)
C2H2 Zn finger 458..478 CDD:275368 8/18 (44%)
C2H2 Zn finger 486..506 CDD:275368
C2H2 Zn finger 514..534 CDD:275368
C2H2 Zn finger 542..562 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.