DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and mynn

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_005162831.1 Gene:mynn ZFINID:ZDB-GENE-030131-5378 Length:823 Species:Danio rerio

Alignment Length:676 Identity:162/677 (24%)
Similarity:237/677 (35%) Gaps:172/677 (25%)


  Fly    59 ICQECRYQLEKSFLFRQRCQWAEKKLRKHIRLLG------------LGKRSRVFSKDPDDYDEDE 111
            :.::.:.|.|:|||........:.:.|.|..:|.            .|:.....:.||:..  ..
Zfish    10 LLEQLKRQRERSFLCDCTVSIGQAQYRAHHNVLAAFSEYFSTQSVDAGREDPTITLDPESV--SS 72

  Fly   112 LEFEDSIAFIEVQDKVRKLEDEKWREDFKEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVR- 175
            ..||..:.:|...|    |..:  ||:.:..|.|..:  |....:..|..|:.:..|.:...:| 
Zfish    73 AIFEKLLTYIYTGD----LNMD--REEIESVQKAASY--LGMPEVVARCTLSQDNIKNVGSPMRQ 129

  Fly   176 ---------------------SEV-RKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLG------ 212
                                 ||| .:||..|.|:  .|||.:........||....:|      
Zfish   130 AEYEDPRSPLSPDDYEPLEPISEVEERELLREDRA--GDDLVSMDEAQSSSEQTPQRVGKRGRKP 192

  Fly   213 ---------ELEVYLTEKKAGRWESLDGSEPETKPQVKE--DASP----------SRSKTKALPK 256
                     |:|....::..||........|..:|...:  |.||          |.|:....|:
Zfish   193 KTRLYEDEFEVETISAQRGRGRGRGRPRGRPRVRPLSSDSTDQSPAHQAMSPNGSSTSRGSGRPR 257

  Fly   257 RRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGS 321
            .||.:    ...:.|.:|.:..|      .|||.|.|..::  :.:||...|:||.....|    
Zfish   258 GRPRV----RPLSTANEDPRNVE------DDPAANKDQEVE--KGNEEQKKETGEKDDGKN---- 306

  Fly   322 DVVHTDNGEIYI----------INSASSEDQNQD-----------STPEFDQDNGITSYNIKEDG 365
               .|||.|...          |...|:|||..:           |.|...:|:..|........
Zfish   307 ---DTDNPEEVTAFKRGRGRPRIKPVSTEDQTTNSENVTTNAEDGSEPAKTKDSEGTGRKRGRPR 368

  Fly   366 EIQFSGEKPEEIEDVVVF--NLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVF 428
            ....|.|.||.:..|.:.  ..|||.||:.:.   |......:.|.|..:.....||||......
Zfish   369 SKPVSSEDPESVISVEISGEEAGEETSQDAEK---HTEEGTEDSESNPGNSVRISKRKRILSRKL 430

  Fly   429 KQESSCPQPKTGRITD-------------TVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKG 480
            |:..:..:.:...:.|             .||..|....|:                        
Zfish   431 KESQAGDEEEEEEMDDEFENDNEDWAGEEEVKPVQDKHRPI------------------------ 471

  Fly   481 GTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCS 545
                |..|....|..|||:|||.||.||||::|:.|..||.|...||.||..|||.|...|..|.
Zfish   472 ----CNICGNLFSEMSSLRRHMRIHKGLKPYQCTLCTRSFRQGNQLKTHMRIHTGEKPFTCTSCD 532

  Fly   546 SCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRS 609
            |.||||..|..|. |:|.|..:.:||..|..:|...|.|..|:..|:|.. :.|.:||::|...|
Zfish   533 SRFAQKCQLVYHC-RMHHGEEKPYKCEFCGAAFATSSNLKIHIRKHSGEKPYECGECGKRFTQAS 596

  Fly   610 AVQRHVTTMHKVKNKLT---DYISET 632
            .:..|       |.:.|   .||.:|
Zfish   597 TLMYH-------KRRHTGEKPYICDT 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 6/27 (22%)
vATP-synt_E 109..>244 CDD:304907 34/175 (19%)
RRF <161..222 CDD:294170 18/99 (18%)
zf-C2H2_8 454..530 CDD:292531 24/76 (32%)
C2H2 Zn finger 485..505 CDD:275368 10/20 (50%)
zf-H2C2_2 497..522 CDD:290200 15/25 (60%)
C2H2 Zn finger 513..533 CDD:275368 9/20 (45%)
zf-H2C2_2 526..550 CDD:290200 13/24 (54%)
C2H2 Zn finger 541..562 CDD:275368 10/21 (48%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
mynnXP_005162831.1 BTB 14..114 CDD:279045 22/110 (20%)
BTB 25..113 CDD:197585 17/98 (17%)
C2H2 Zn finger 472..492 CDD:275368 10/20 (50%)
zf-H2C2_2 484..509 CDD:290200 15/25 (60%)
C2H2 Zn finger 500..520 CDD:275368 9/20 (45%)
zf-H2C2_2 513..537 CDD:290200 13/24 (54%)
C2H2 Zn finger 528..548 CDD:275368 10/21 (48%)
zf-H2C2_2 541..566 CDD:290200 9/26 (35%)
zf-C2H2 555..577 CDD:278523 7/22 (32%)
C2H2 Zn finger 557..577 CDD:275368 6/20 (30%)
zf-H2C2_2 569..594 CDD:290200 8/25 (32%)
C2H2 Zn finger 585..605 CDD:275368 7/27 (26%)
zf-H2C2_2 598..621 CDD:290200 6/26 (23%)
C2H2 Zn finger 613..633 CDD:275368 1/4 (25%)
C2H2 Zn finger 641..661 CDD:275368
C2H2 Zn finger 669..685 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.