DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb16a

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_955929.1 Gene:zbtb16a ZFINID:ZDB-GENE-030131-1989 Length:671 Species:Danio rerio

Alignment Length:636 Identity:127/637 (20%)
Similarity:227/637 (36%) Gaps:193/637 (30%)


  Fly    99 VFSKDPDDYDEDELE---FEDSIAF---IEVQDKVRKLEDEKWREDFKEEQAAEMHKRLVKSRLE 157
            :|.::...|..|.|.   |:..:.:   ..:|.||..|:|..:        |||:        ||
Zfish    62 LFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKVEDLDDLLY--------AAEI--------LE 110

  Fly   158 LRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVYLTEKK 222
            :              |...|...::.|.::|...:|....:::...::.            .|:|
Zfish   111 I--------------EYLEEQCLKILETIQSSDENDTEVNMNDGGTEDD------------EERK 149

  Fly   223 AGRWESLDGSEPETKPQVKE-----------------DASPS---------RSKTKALPKRRPSL 261
            .....:|.||:   |...:|                 |.|||         .|.|||......|:
Zfish   150 GRHGRNLVGSK---KHSTEESGYVSAAQQALALPGMVDQSPSVSTSFGLSTMSPTKAAVDSLMSI 211

  Fly   262 VDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHT 326
            ..:.|::|.......|:.  |..|:.|. ..::..:.:::||....||.:        ..:.:.:
Zfish   212 GQSLLQSTMHPGVGAEQP--LHGNSHPM-MGEIKTEMMQVDESGEHESPK--------AMESIAS 265

  Fly   327 DNGEIYIINSASSEDQNQDSTPEFDQDNGITS----YNIKEDGEIQFSGEKPEEIEDVVVFNLGE 387
            .|||     .:...|:|:|......:.:.|||    :.::::|    .|::..|:.     .:|.
Zfish   266 SNGE-----RSGEPDKNRDGPGTPTRSSVITSARELHYVRDEG----LGDQQAEVS-----QMGL 316

  Fly   388 EI---SQEQQVFSFHENVIIVEKEQNDRDEQTPLKR----KRSSELVFKQESSC-----PQ---- 436
            |.   ..|:.:.|.:.   |....:|:.....|...    ..|..|....:.|.     ||    
Zfish   317 EAMAGMTEKHLASLYG---IPSNHKNEAMLSMPASMASSLHMSPALAMSMDFSAYGGLLPQSFIQ 378

  Fly   437 ----PKTGRITDTVK------SFQCHLCPVAFPTQKLLTRHHNTHIKGLK--------------- 476
                .|.|.:...:|      :.:|::|....|..:.:.:|...| .|:|               
Zfish   379 REFFSKLGELAAGIKPDGRSLNERCNVCGAELPDNEAIEQHRKLH-SGMKTYGCELCGKRFLDSL 442

  Fly   477 --------------------------------------SGKGGTLKCPSCALQLSCASSLKRHMI 503
                                                  :|....:.|..|..:....::|::||.
Zfish   443 RLRMHLLSHSAGEKAIVCDQCGAQFQKEDALEAHRQIHTGSDMAIFCLLCGKRFQTQTALQQHME 507

  Fly   504 IHTGLKPFKCSECELSFSQREVLKRHMDTHT-GVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSR 567
            :|.|::.:.||||..:|.....||||:.:|| |....:|..|.|||..:|.|:.| .|:|.| .:
Zfish   508 VHAGVRSYICSECNRTFPSHTALKRHLRSHTAGDHPFECEFCGSCFRDESTLKGH-KRIHTG-EK 570

  Fly   568 THKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTT 617
            .::|:.|.:.|:....|..|...|.|.. |.||.|.::..|.||:.:|:.|
Zfish   571 PYECNGCGKKFSLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRT 621

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 26/158 (16%)
RRF <161..222 CDD:294170 6/61 (10%)
zf-C2H2_8 454..530 CDD:292531 23/129 (18%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 10/25 (40%)
C2H2 Zn finger 513..533 CDD:275368 9/20 (45%)
zf-H2C2_2 526..550 CDD:290200 12/25 (48%)
C2H2 Zn finger 541..562 CDD:275368 9/21 (43%)
C2H2 Zn finger 571..591 CDD:275368 5/20 (25%)
C2H2 Zn finger 598..617 CDD:275368 7/19 (37%)
zbtb16aNP_955929.1 BTB 25..106 CDD:279045 11/52 (21%)
BTB 35..>106 CDD:197585 11/52 (21%)
C2H2 Zn finger 403..423 CDD:275368 4/20 (20%)
C2H2 Zn finger 431..451 CDD:275368 0/20 (0%)
COG5048 <445..620 CDD:227381 46/177 (26%)
C2H2 Zn finger 460..480 CDD:275368 0/20 (0%)
C2H2 Zn finger 489..509 CDD:275368 5/20 (25%)
zf-C2H2 515..537 CDD:278523 9/22 (41%)
C2H2 Zn finger 517..537 CDD:275368 9/20 (45%)
C2H2 Zn finger 546..566 CDD:275368 9/21 (43%)
zf-H2C2_2 559..582 CDD:290200 8/25 (32%)
C2H2 Zn finger 574..594 CDD:275368 5/20 (25%)
zf-H2C2_2 587..608 CDD:290200 8/21 (38%)
C2H2 Zn finger 602..622 CDD:275368 8/21 (38%)
C2H2 Zn finger 630..650 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.