DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zbtb26

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_950190.2 Gene:Zbtb26 MGIID:2444402 Length:440 Species:Mus musculus

Alignment Length:348 Identity:81/349 (23%)
Similarity:130/349 (37%) Gaps:108/349 (31%)


  Fly   227 ESLDGSEPET-KPQVKEDASPSRSKTKA-LPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPA 289
            :|.:||||:: .||.||....:|...|. ||...||            :|:.:.|          
Mouse   134 DSKEGSEPQSASPQSKEQQGDARGSPKQDLPCIHPS------------EDSMDME---------- 176

  Fly   290 NNSDVNIDGLELDEEVPAE-SGEDFREINMVGSD--VVHTDNGEIYIINSASSEDQNQDSTPEFD 351
             :||:.|..:|...:|..: |.:|  |...:.|:  .:|:...:..:|||......|     |.|
Mouse   177 -DSDIQIVKVESIGDVSEDRSKKD--ENQYISSEPTALHSSEPQHSLINSTVENRVN-----ELD 233

  Fly   352 QDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFN---LGEEISQEQQVFSFHENVIIVEKEQNDRD 413
            |.: :.:|.:...|.           :|:::.:   .|..|....:...:|.             
Mouse   234 QSH-LHNYALSYTGN-----------DDIIMTSKDVFGPNIRGVDKGLQWHH------------- 273

  Fly   414 EQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSG 478
                                                ||..|...|       ||...:...||..
Mouse   274 ------------------------------------QCPKCTRVF-------RHLENYANHLKMH 295

  Fly   479 KGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQ 543
            |  ...|..|....:...:|.|||.:|.|:|||:|..|..:|||:..|:.|::.|:|.|.|:|..
Mouse   296 K--LFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFSQKCSLQDHLNLHSGDKPHKCNY 358

  Fly   544 CSSCFAQKSNLQQHIGRVHMGNS 566
            |...||.|..|::|:.::|..||
Mouse   359 CDMVFAHKPVLRKHLKQLHGKNS 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 9/18 (50%)
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 25/76 (33%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
Zbtb26NP_950190.2 BTB 23..123 CDD:306997
C2H2 Zn finger 275..295 CDD:275368 7/27 (26%)
zf-C2H2 298..320 CDD:306579 6/22 (27%)
C2H2 Zn finger 300..320 CDD:275368 6/20 (30%)
zf-H2C2_2 315..337 CDD:316026 12/22 (55%)
C2H2 Zn finger 328..348 CDD:275368 7/20 (35%)
zf-H2C2_2 340..365 CDD:316026 10/25 (40%)
C2H2 Zn finger 356..374 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.