DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp189

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001101400.1 Gene:Zfp189 RGDID:1306510 Length:608 Species:Rattus norvegicus

Alignment Length:361 Identity:95/362 (26%)
Similarity:155/362 (43%) Gaps:75/362 (21%)


  Fly   306 PAESGEDFREIN----MVGSDVVHTDNGEIYIINSASSEDQNQDSTP----EFDQD---NGITSY 359
            |.||.|::..::    .:..|||....|::.   |....::|:|..|    |.::|   .||...
  Rat     7 PLESKEEWGYLDAAPRSLYKDVVMDSYGKLV---SLDVLNRNEDEEPTVKEEIEKDIEPQGIIVT 68

  Fly   360 NIKEDGEIQFSGEKPEEI-------EDVVVFNL-GEEISQEQQVFSFHENVIIVEKEQNDRD--- 413
            .||.:.:....|.:..|:       ..:.::.: .:.:::||::|..|.|   |.|..|..:   
  Rat    69 RIKSELDQDPMGSETFELVGRLDKQRGIFLWEIPRDSLTEEQKMFRGHTN---VRKRPNSEEKCH 130

  Fly   414 --EQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLK 476
              |:...:..|.:..:..|          |:....|.|||:.|..:|.....:..|...|     
  Rat   131 KCEECGKRFVRKAHFIQHQ----------RVHTGEKPFQCNECGKSFSRSSFVIEHQRIH----- 180

  Fly   477 SGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQC 541
            :|: ...:|..|....|.:|:|.||..||||.:|::|::|:.|||||..|.:|...|||.|.|:|
  Rat   181 TGE-RPYECNYCGKTFSVSSTLIRHQRIHTGERPYQCNQCKQSFSQRRSLVKHQRIHTGEKPHKC 244

  Fly   542 PQCSSCFAQKSNL----QQHIG-----------------------RVHMGNSRTHKCHLCHRSFN 579
            ..|...|:.||:|    :.|.|                       |:|.| .|.|||..|.::|.
  Rat   245 SDCGKAFSWKSHLIEHQRTHTGEKPYHCTKCKKSFSRNSLLVEHQRIHTG-ERPHKCGECGKAFR 308

  Fly   580 HVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRH 614
            ..:.|.:|...|.|.. |.|.:||:.|:..|.:..|
  Rat   309 LSTYLIQHQKIHTGEKPFLCIECGKSFSRSSFLIEH 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 26/76 (34%)
C2H2 Zn finger 485..505 CDD:275368 8/20 (40%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 9/20 (45%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 9/48 (19%)
C2H2 Zn finger 571..591 CDD:275368 5/20 (25%)
C2H2 Zn finger 598..617 CDD:275368 6/18 (33%)
Zfp189NP_001101400.1 KRAB_A-box <10..39 CDD:143639 7/32 (22%)
COG5048 116..506 CDD:227381 72/250 (29%)
C2H2 Zn finger 132..152 CDD:275368 4/30 (13%)
zf-H2C2_2 144..169 CDD:290200 8/35 (23%)
C2H2 Zn finger 160..180 CDD:275368 4/20 (20%)
zf-H2C2_2 175..196 CDD:290200 5/27 (19%)
C2H2 Zn finger 188..208 CDD:275368 8/20 (40%)
zf-H2C2_2 201..225 CDD:290200 13/24 (54%)
C2H2 Zn finger 216..236 CDD:275368 9/20 (45%)
zf-H2C2_2 228..252 CDD:290200 10/24 (42%)
C2H2 Zn finger 244..264 CDD:275368 6/20 (30%)
zf-H2C2_2 256..281 CDD:290200 3/25 (12%)
C2H2 Zn finger 272..292 CDD:275368 1/20 (5%)
zf-H2C2_2 285..307 CDD:290200 8/23 (35%)
C2H2 Zn finger 300..320 CDD:275368 5/20 (25%)
zf-H2C2_2 312..337 CDD:290200 9/25 (36%)
C2H2 Zn finger 328..348 CDD:275368 6/18 (33%)
zf-H2C2_2 341..365 CDD:290200 1/5 (20%)
C2H2 Zn finger 356..376 CDD:275368
zf-H2C2_2 368..393 CDD:290200
C2H2 Zn finger 384..404 CDD:275368
C2H2 Zn finger 440..460 CDD:275368
zf-H2C2_2 452..477 CDD:290200
C2H2 Zn finger 468..488 CDD:275368
zf-H2C2_2 481..505 CDD:290200
C2H2 Zn finger 496..516 CDD:275368
zf-H2C2_2 508..533 CDD:290200
C2H2 Zn finger 524..544 CDD:275368
zf-H2C2_2 537..561 CDD:290200
C2H2 Zn finger 552..572 CDD:275368
C2H2 Zn finger 583..603 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.