DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zbtb26

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001101310.1 Gene:Zbtb26 RGDID:1308561 Length:451 Species:Rattus norvegicus

Alignment Length:350 Identity:83/350 (24%)
Similarity:125/350 (36%) Gaps:112/350 (32%)


  Fly   227 ESLDGSEPET-KPQVKEDASPSRSKTKA-LPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPA 289
            :|.:||||:: .||.||....:|...|. ||...||            :|:.:.|          
  Rat   145 DSKEGSEPQSASPQSKEQQGDARGSPKQDLPCIHPS------------EDSMDME---------- 187

  Fly   290 NNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDN 354
             :||:.|        |..||..|..|                    ..|.:||||          
  Rat   188 -DSDIQI--------VKVESIGDVSE--------------------DRSKKDQNQ---------- 213

  Fly   355 GITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQ-----QVFSFHENVIIVEKE---QND 411
                 .|..:.....|.|....:.:..|.|...|:.|..     ..::.::::|:..|:   .|.
  Rat   214 -----YISSEPTALHSSEPQHSLINSTVENRVNELDQSHLHNYALSYTGNDDIIMTSKDVFGPNI 273

  Fly   412 RDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLK 476
            |.....|:...                           ||..|...|       ||...:...||
  Rat   274 RGVDKGLQWHH---------------------------QCPKCTRVF-------RHLENYANHLK 304

  Fly   477 SGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQC 541
            ..|  ...|..|....:...:|.|||.:|.|:|||:|..|..:|||:..|:.|::.|:|.|.|:|
  Rat   305 MHK--LFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFSQKCSLQDHLNLHSGDKPHKC 367

  Fly   542 PQCSSCFAQKSNLQQHIGRVHMGNS 566
            ..|...||.|..|::|:.::|..||
  Rat   368 NYCDMVFAHKPVLRKHLKQLHGKNS 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 9/18 (50%)
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 25/76 (33%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
Zbtb26NP_001101310.1 BTB 34..134 CDD:279045
BTB 45..138 CDD:197585
C2H2 Zn finger 286..306 CDD:275368 7/27 (26%)
zf-C2H2 309..331 CDD:278523 6/22 (27%)
C2H2 Zn finger 311..331 CDD:275368 6/20 (30%)
zf-H2C2_2 326..348 CDD:290200 12/22 (55%)
C2H2 Zn finger 339..359 CDD:275368 7/20 (35%)
zf-H2C2_2 351..376 CDD:290200 10/25 (40%)
C2H2 Zn finger 367..385 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.