DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zbtb11

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001100567.1 Gene:Zbtb11 RGDID:1308275 Length:1052 Species:Rattus norvegicus

Alignment Length:724 Identity:158/725 (22%)
Similarity:251/725 (35%) Gaps:204/725 (28%)


  Fly    20 EHQDAYAIFDEDDTQLS-----IPVRLMACVALDAKAT--DTLPKRICQECRYQLEKSFLFRQRC 77
            |.:|..:.|....|..|     .||.....|.:|.|..  .:.||. ||....||.:..|..|.|
  Rat   151 ESEDDLSNFTSPPTTASKTSKKKPVSKHELVFVDTKGVVKRSSPKH-CQAVLKQLNEQRLSNQFC 214

  Fly    78 QWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWREDFKEE 142
            .         :.||                    :|.|:    .:....|.....|.:|:.|.|:
  Rat   215 D---------VTLL--------------------IEGEE----YKAHKSVLSANSEYFRDLFIEK 246

  Fly   143 QAAEMHKRLV-------KSRLELRAKLTTELRK----------------------ELAEEVRSEV 178
            .|...|:.:|       .|.|.|.....|.:..                      |:.|.|...:
  Rat   247 GAVSSHEAVVDLSGFCKASFLPLLEFAYTSVLSFDFCSMADVAVLARHLFMSEVLEICESVHKLM 311

  Fly   179 -RKELAEEVRSQVR-----DDL------------RNEVSEDIRKEQLAMLLGELEVYLTEKKAGR 225
             .|:|....:.:|:     .||            |||.:..:..:     ||..|:.|.      
  Rat   312 EEKQLTVYKKGEVQTVASTQDLAAHNGAATPPGPRNEATTTLSSD-----LGHCEIVLL------ 365

  Fly   226 WESLDGSEPETK----------PQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEF 280
               ::|..|||:          |||..:|..|.|....:| ..|:.:.|...|||:.:...|...
  Rat   366 ---VNGEVPETEQNGEPGQQPAPQVSAEAEASVSPAGCIP-NPPTEMGAASLATESNQPELESAV 426

  Fly   281 ILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQD 345
            :         ..|..:      ..||.:..|:         :|::|...:..|.|..|.||   .
  Rat   427 V---------REDGGV------ASVPPKISEE---------NVINTSQEDSDIGNDTSPED---T 464

  Fly   346 STPEFDQDNGITSYNIKEDGEIQFSGEKPE--EIEDVVVFNLGEEISQEQQVFSFHENVIIVEKE 408
            .|.:|...:..:...:|::..:..:.||.:  :.:|.....|.:....|......|:.   :||:
  Rat   465 CTKDFSDHSQSSGQPLKDEETLIEATEKTDSGQDDDTYRSRLRQRSVNEGGYIRLHKG---MEKK 526

  Fly   409 QNDRDEQTPLKRKRSSELVFKQESSCPQPKTGR------------------------ITDTVK-- 447
            ...|...:....::.::.:.::.....|||...                        |..|:|  
  Rat   527 LQKRKAISKSAVQQVAQKLVQRGKKMKQPKRDAKESAEETPHKCGECGMVFPRRYAFIMHTLKHE 591

  Fly   448 ---SFQCHLCPVAFPTQKLLTRHHNTHIK-----------------GLKSGKGGTLK---CPSCA 489
               .::|.||...|.....|..|...|.:                 |..|.||.|.:   |..|.
  Rat   592 RARDYKCPLCKKQFQYSASLRAHLIRHTRKDAPTSSSSNSTSNEASGASSEKGRTKREFICSICG 656

  Fly   490 LQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNL 554
            ..|....||:.||:.|||:||..|..|..:|..:..||.|...|...|:.||..|...|..|.:|
  Rat   657 RTLPKLYSLRIHMLKHTGVKPHACQVCGKTFIYKHGLKLHQSLHQSQKQFQCELCVKSFVTKRSL 721

  Fly   555 QQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTH------AGVMFSCKQCGRQFNDRSAVQR 613
            |:|:. :|.|.|: :.|.:|.:||:..||||:||..|      .|  :.|.||.:.|.:...:::
  Rat   722 QEHMS-IHTGESK-YFCSVCGKSFHRGSGLSKHLKKHQPKPEVRG--YHCTQCEKSFFEARDLRQ 782

  Fly   614 HVTTMHKVK 622
            |:.....||
  Rat   783 HMNKHLGVK 791

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 19/73 (26%)
vATP-synt_E 109..>244 CDD:304907 36/192 (19%)
RRF <161..222 CDD:294170 16/101 (16%)
zf-C2H2_8 454..530 CDD:292531 28/96 (29%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 10/20 (50%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
Zbtb11NP_001100567.1 BTB 204..305 CDD:279045 21/134 (16%)
BTB 215..306 CDD:197585 18/124 (15%)
C2H2 Zn finger 570..590 CDD:275368 3/20 (15%)
C2H2 Zn finger 598..618 CDD:275368 6/20 (30%)
C2H2 Zn finger 652..672 CDD:275368 7/20 (35%)
zf-H2C2_2 664..689 CDD:290200 12/25 (48%)
C2H2 Zn finger 680..700 CDD:275368 6/20 (30%)
C2H2 Zn finger 708..728 CDD:275368 7/21 (33%)
zf-H2C2_2 720..745 CDD:290200 10/27 (37%)
C2H2 Zn finger 736..756 CDD:275368 10/20 (50%)
C2H2 Zn finger 767..787 CDD:275368 5/20 (25%)
zf-H2C2_2 779..803 CDD:290200 3/14 (21%)
C2H2 Zn finger 795..815 CDD:275368
C2H2 Zn finger 859..879 CDD:275368
C2H2 Zn finger 887..907 CDD:275368
zf-H2C2_2 899..922 CDD:290200
C2H2 Zn finger 915..936 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.