DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Bcl6

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001100554.1 Gene:Bcl6 RGDID:1309345 Length:707 Species:Rattus norvegicus

Alignment Length:607 Identity:119/608 (20%)
Similarity:201/608 (33%) Gaps:167/608 (27%)


  Fly    70 SFLFRQRCQWAEKKLRKHIRLLGLGKRSRVFSKD-----------PDDYDEDELEFEDSIAFIEV 123
            ||||      ::::||...|:    ..:..|.|:           |::|....:|...|:....:
  Rat   205 SFLF------SDEELRDAPRM----PVANPFPKERALPCDSARPVPNEYSRPTMEVSPSLCHSNI 259

  Fly   124 QDKVRKLEDEKWREDFKEEQAAEMHKRLVK--------------------SRLELRAKLTTELRK 168
            ...         :|...||..:::|..:.:                    |:.|.|.....|:..
  Rat   260 YSP---------KEAVPEEARSDIHYSVTEGPKPAAPSARHASYFPCDKASKEEERPSSEDEIAL 315

  Fly   169 ELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVYL---TEKKAGRWES-- 228
            ..........||.|......|..|...|..:|....:...:|........   |:.||..|:.  
  Rat   316 HFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESSSSKNACILQASGSPPAKSPTDPKACNWKKYK 380

  Fly   229 ---LDGSEPETKPQVKEDASPSRSKTKALPKR---RPSLVDANLKATEARKDAKEEEFILGCNTD 287
               |:......||:..|.|...|...:|.|..   :|.:..|||......|.:...|        
  Rat   381 FIVLNSLNQNAKPEGSEQAELGRLSPRAYPAPPACQPPMEPANLDLQSPTKLSASGE-------- 437

  Fly   288 PANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQ 352
                          |..:|..|    |..|:|...:            :.|....::..:|.:..
  Rat   438 --------------DSTIPQAS----RLNNIVNRSL------------AGSPRSSSESHSPLYMH 472

  Fly   353 DNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLG----EEISQEQQVFSFHENVIIVEKEQNDRD 413
            ....||           .|.:..:..::.:...|    ||:.:.|..:|                
  Rat   473 PPKCTS-----------CGSQSPQHTEMCLHTAGPTFPEEMGETQSEYS---------------- 510

  Fly   414 EQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSG 478
                             :|||   :.|       :|.|:.|...|..:..|.||      .|::.
  Rat   511 -----------------DSSC---ENG-------AFFCNECDCRFSEEASLKRH------TLQTH 542

  Fly   479 KGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQ 543
            .....||..|........:|..|..:|||.||::|:.|...|::...||.|...|:|.|.::|..
  Rat   543 SDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPYKCET 607

  Fly   544 CSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFND 607
            |.:.|.|.::|:.|: .:|.| .:.:.|.:|...|.|:..|..||..|.|.. :.|::|...|..
  Rat   608 CGARFVQVAHLRAHV-LIHTG-EKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRH 670

  Fly   608 RSAVQRHVTTMH-KVKNKLTDY 628
            :|.::.|:...| .:.|....|
  Rat   671 KSQLRLHLRQKHGAITNTKVQY 692

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 6/16 (38%)
vATP-synt_E 109..>244 CDD:304907 26/163 (16%)
RRF <161..222 CDD:294170 10/64 (16%)
zf-C2H2_8 454..530 CDD:292531 22/76 (29%)
C2H2 Zn finger 485..505 CDD:275368 4/20 (20%)
zf-H2C2_2 497..522 CDD:290200 10/25 (40%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
Bcl6NP_001100554.1 BTB 22..126 CDD:279045
BTB 33..126 CDD:197585
C2H2 Zn finger 521..542 CDD:275368 7/27 (26%)
C2H2 Zn finger 549..569 CDD:275368 4/20 (20%)
zf-H2C2_2 561..586 CDD:290200 10/25 (40%)
C2H2 Zn finger 577..597 CDD:275368 6/20 (30%)
zf-H2C2_2 589..614 CDD:290200 9/25 (36%)
C2H2 Zn finger 605..625 CDD:275368 6/21 (29%)
zf-H2C2_2 617..642 CDD:290200 7/27 (26%)
C2H2 Zn finger 633..653 CDD:275368 7/20 (35%)
zf-H2C2_2 646..670 CDD:290200 8/24 (33%)
C2H2 Zn finger 661..679 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.