DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zbtb7b

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_006232676.1 Gene:Zbtb7b RGDID:1305963 Length:543 Species:Rattus norvegicus

Alignment Length:401 Identity:97/402 (24%)
Similarity:139/402 (35%) Gaps:136/402 (34%)


  Fly   214 LEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEE 278
            ||.:.|.........:...| ::.|||.....|.       |..||          .||:..|..
  Rat   163 LEAFATATTTASTSGMPNGE-DSPPQVPLLPPPP-------PPPRP----------VARRSRKPR 209

  Fly   279 EFILGCNTDPANNSDVNIDGLELDEEVPAESGED--FREINMVGSDVVHTDNGEIYIINSASSED 341
            :..|......||:         |..|.|......  :.|..|||.           :.||..|..
  Rat   210 KAFLQTKGARANH---------LVPEAPTVLTHPLAYEEEEMVGR-----------VGNSGGSGL 254

  Fly   342 QNQDSTPEFDQDNGITSYNIKEDGEIQ---FSGEKPEEIEDVV---VFNLG---------EEISQ 391
            .:..|.|.     |.||   ..:|.:.   |.||  ||.|::|   .:.|.         ||:..
  Rat   255 GDNYSPPA-----GATS---PAEGPLNYEVFEGE--EEEEELVYPPAYGLAQSNEPSLSPEELGS 309

  Fly   392 EQQ---------VFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVK 447
            ::.         :.|.|::.:     ....|.|..|.|||.|::        ||           
  Rat   310 DEDPIDPDLMAYLSSLHQDAL-----APGLDGQDKLVRKRRSQM--------PQ----------- 350

  Fly   448 SFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFK 512
                                                :||.|...:..|..|.|||..|||.|||.
  Rat   351 ------------------------------------ECPVCHKIIHGAGKLPRHMRTHTGEKPFA 379

  Fly   513 CSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRS 577
            |..|.:.|::.:.||.||..|||.:.:.||.|.:.|....:|:.|: .:|.|: |.::|||||::
  Rat   380 CEVCGVRFTRNDKLKIHMRKHTGERPYSCPHCPARFLHSYDLKNHM-HLHTGD-RPYECHLCHKA 442

  Fly   578 FNHVSGLSRHL 588
            |.....|.|||
  Rat   443 FAKEDHLQRHL 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 7/30 (23%)
RRF <161..222 CDD:294170 3/8 (38%)
zf-C2H2_8 454..530 CDD:292531 20/76 (26%)
C2H2 Zn finger 485..505 CDD:275368 8/20 (40%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 11/24 (46%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 10/19 (53%)
C2H2 Zn finger 598..617 CDD:275368
Zbtb7bXP_006232676.1 BTB 24..142 CDD:279045
BTB 35..141 CDD:197585
COG5048 349..>428 CDD:227381 32/127 (25%)
C2H2 Zn finger 352..372 CDD:275368 8/20 (40%)
zf-H2C2_2 367..389 CDD:290200 12/22 (55%)
C2H2 Zn finger 380..400 CDD:275368 7/20 (35%)
zf-H2C2_2 393..417 CDD:290200 11/24 (46%)
C2H2 Zn finger 408..428 CDD:275368 6/21 (29%)
zf-H2C2_2 420..444 CDD:290200 11/26 (42%)
C2H2 Zn finger 436..454 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.