DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp161

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_758828.2 Gene:Zfp161 RGDID:628712 Length:449 Species:Rattus norvegicus

Alignment Length:571 Identity:134/572 (23%)
Similarity:207/572 (36%) Gaps:172/572 (30%)


  Fly    97 SRVFSKDPDDY--------DEDELEFE-DSIAFIEVQDKVRKLEDEKWREDFKEEQAAEMHKRLV 152
            |.....:.||:        :|..||.| ..||.:        :||.|:|.......|...:.:.:
  Rat     8 SETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIV--------VEDVKFRAHRCVLAACSTYFKKL 64

  Fly   153 KSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGE-LEV 216
            ..:||:.:....|:         ..:|.::.|||.:.:.....:...||:   .|.|..|: |.:
  Rat    65 FKKLEVDSSSVIEI---------DFLRSDIFEEVLNYMYTAKISVKKEDV---NLMMSSGQILGI 117

  Fly   217 YLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFI 281
            ...:|...  :..|.|.|        |.|..:||:|...|....:.|    |.:|:.|..||   
  Rat   118 RFLDKLCS--QKRDVSSP--------DESNGQSKSKYCLKLNRPIGD----AADAQDDDVEE--- 165

  Fly   282 LGCNTDPANNSDVNIDG--------------LELDEEVPAESG-EDFREINMVGSDVVHTDNGEI 331
            :|...|  :.||..::|              |.:.|.:..|.| |:.|::|..|.:|...:    
  Rat   166 IGDQDD--SPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESME---- 224

  Fly   332 YIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVF 396
                           ||| .:|.|                                  ||..|..
  Rat   225 ---------------TPE-SKDLG----------------------------------SQTPQAL 239

  Fly   397 SFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQ 461
            :|::.:..|      :|||||.....:|::.|                                :
  Rat   240 TFNDGMSEV------KDEQTPGWTTAASDMKF--------------------------------E 266

  Fly   462 KLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVL 526
            .||..||...|           .|.:|....|....|::|..:||..:||.|..|...|:.:..|
  Rat   267 YLLYGHHREQI-----------ACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHL 320

  Fly   527 KRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTH 591
            |.|:..|||.|.:.|..|...|.:..:|::| .||| .|.|...||:|.::|.|.|.|..|...|
  Rat   321 KEHLKIHTGYKPYSCEVCGKSFIRAPDLKKH-ERVH-SNERPFACHMCDKAFKHKSHLKDHERRH 383

  Fly   592 AGVM-FSCKQCGRQFNDRSAVQRHVTTMHKVKNKLTDYI--SETNEFQAVA 639
            .|.. |.|..|.:.|...|.::||...||..:.::|...  |||.:.||.|
  Rat   384 RGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPSAIQSETEQLQAAA 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 29/137 (21%)
RRF <161..222 CDD:294170 12/62 (19%)
zf-C2H2_8 454..530 CDD:292531 20/76 (26%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 9/25 (36%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
Zfp161NP_758828.2 BTB 26..132 CDD:306997 27/128 (21%)
C2H2 Zn finger 279..299 CDD:275368 5/20 (25%)
SFP1 <303..383 CDD:227516 30/82 (37%)
C2H2 Zn finger 307..327 CDD:275368 6/20 (30%)
C2H2 Zn finger 335..355 CDD:275368 7/21 (33%)
C2H2 Zn finger 363..383 CDD:275368 8/20 (40%)
zf-H2C2_2 375..400 CDD:316026 8/25 (32%)
C2H2 Zn finger 391..407 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.