DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zbtb24

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_700447.2 Gene:Zbtb24 MGIID:3039618 Length:710 Species:Mus musculus

Alignment Length:322 Identity:86/323 (27%)
Similarity:130/323 (40%) Gaps:86/323 (27%)


  Fly   329 GEIYI-INSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQE 392
            ||:.: :|::....||               :..||:..::.|.:.||:.|....   ||..|.|
Mouse   182 GELQLRVNNSVQNRQN---------------FVFKEEDSVKLSEQTPEDKESEPA---GEPGSVE 228

  Fly   393 QQVFSFHENVIIVEKEQN---------------------------------DRDEQTPLKRKRSS 424
            :         :..||::|                                 |.|:|:..||....
Mouse   229 E---------VPAEKDENFDPKAGDGQESQSRCSRRRIRRSVKLKDYKLLGDEDDQSTAKRLCGR 284

  Fly   425 ELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCA 489
                |:.||.|:.:            |..|...|.....|..|...|     :|: ...||..|.
Mouse   285 ----KKRSSGPEAR------------CKDCDRVFKYSHFLAIHQRRH-----TGE-RPFKCNECG 327

  Fly   490 LQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNL 554
            ...:...||:.|..:|||.:|:.|:.|..:.:.:..|..||..|:|.|...|.||...|:||..|
Mouse   328 KGFAQKHSLQVHTRMHTGERPYTCTVCGKALTTKHSLLEHMSLHSGQKSFTCDQCGKYFSQKRQL 392

  Fly   555 QQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHV 615
            :.|. |||.|:| ..:|..|||.|..||.|.:||.||.|.. |:|:.||:.|..:|::|.|:
Mouse   393 KSHY-RVHTGHS-LPECSHCHRKFMDVSQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQTHI 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 20/76 (26%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 9/25 (36%)
C2H2 Zn finger 513..533 CDD:275368 5/20 (25%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 10/21 (48%)
C2H2 Zn finger 571..591 CDD:275368 11/20 (55%)
C2H2 Zn finger 598..617 CDD:275368 7/19 (37%)
Zbtb24NP_700447.2 BTB 27..128 CDD:279045
BTB 38..133 CDD:197585
C2H2 Zn finger 295..315 CDD:275368 5/20 (25%)
zf-H2C2_2 308..332 CDD:290200 7/30 (23%)
COG5048 <320..479 CDD:227381 52/136 (38%)
C2H2 Zn finger 323..343 CDD:275368 5/20 (25%)
zf-H2C2_2 335..360 CDD:290200 9/25 (36%)
C2H2 Zn finger 351..371 CDD:275368 5/20 (25%)
zf-H2C2_2 363..388 CDD:290200 10/25 (40%)
C2H2 Zn finger 379..399 CDD:275368 10/21 (48%)
COG5048 406..>563 CDD:227381 21/48 (44%)
C2H2 Zn finger 407..427 CDD:275368 11/20 (55%)
zf-H2C2_2 420..443 CDD:290200 11/23 (48%)
C2H2 Zn finger 435..455 CDD:275368 7/19 (37%)
zf-H2C2_2 447..471 CDD:290200 2/7 (29%)
C2H2 Zn finger 463..479 CDD:275368
zf-H2C2_2 477..500 CDD:290200
C2H2 Zn finger 491..511 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.