DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp354a

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_434685.1 Gene:Zfp354a RGDID:2967 Length:576 Species:Rattus norvegicus

Alignment Length:643 Identity:136/644 (21%)
Similarity:230/644 (36%) Gaps:155/644 (24%)


  Fly     6 SYPDLATLCRL---------CLKEHQDAYAIFDEDDTQLSIPVRLMACVALDAKATDTLPKRICQ 61
            :|.:||::...         .|::.:|.:.:..|.....|:.::   |.....|:|.|      |
  Rat    46 NYSNLASMAGFLFTKPKVISLLQQGEDPWQVEKEGPRYFSLGLK---CSHRTTKSTQT------Q 101

  Fly    62 ECRYQLEKSFLFRQRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDK 126
            :..:|              |..:|         |..|.|:.:|.:...:.|...:.         
  Rat   102 DSSFQ--------------ELIVR---------KSKRTFAFEPLNMKSENLFIHEG--------- 134

  Fly   127 VRKLEDEKWREDFKEEQAAEMHKRLVKSRLELRAKLTTELRKELA-----EEVRSEVRKE--LAE 184
              ||| |||  |.........||....|....|.|.::|.:|:::     ..:..:.|.:  :.|
  Rat   135 --KLE-EKW--DKNTLTVERSHKNNEFSPKSHREKRSSECKKQISYLSNPPGITPDKRYKCSMCE 194

  Fly   185 EV---RSQVRDDLRNEVSEDIRK-EQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDAS 245
            :.   .|.:|...:|...|.:.| ::.:....:....:..:.....|         ||.|.::..
  Rat   195 KTFINTSSLRKHEKNHSGEKLFKCKECSKAFSQSSALIQHQITHTGE---------KPYVCKECG 250

  Fly   246 PSRSKTKALPKR-RPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPA-E 308
            .:.:.:.:|.|. |...|:.:.:..|..|...:.                  .||.:.:::.| |
  Rat   251 KAFTLSTSLYKHLRTHTVEKSYRCKECGKSFGQR------------------SGLFIHQKIHARE 297

  Fly   309 SGEDFR-----EINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQ 368
            :...:.     ..::.|....|: ..:.|:.|...:                    ..|....::
  Rat   298 NPHRYNPGRKASASLSGCQRAHS-RKKTYLCNECGN--------------------TFKSSSSLR 341

  Fly   369 F-----SGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVF 428
            :     :||||....:     .|...||...:.. ||.:            .|..|..|..| ..
  Rat   342 YHQRIHTGEKPFRCSE-----CGRAFSQSASLIQ-HERI------------HTGEKPYRCGE-CG 387

  Fly   429 KQESSCPQPKTGRITDT-VKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQL 492
            |..:|..:....||..| .|.:.|:.|..|..:...|..|...| .|.|     ..||..|....
  Rat   388 KGFTSISRLNRHRIIHTGEKLYNCNECGKALSSHSTLIIHERIH-TGEK-----PCKCKVCGKAF 446

  Fly   493 SCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQH 557
            ..:|:|.:|..:|||.:|:||:||..:|.....|..|...|||.|.:||.:|...|.|.|.|.||
  Rat   447 RQSSALIQHQRMHTGERPYKCNECGKTFRCNSSLSNHQRIHTGEKPYQCIECGMSFGQSSALIQH 511

  Fly   558 IGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRH 614
             .|:|.| .:..||:.|.::|...|....|...|.|.. :.|..||:.||.||::..|
  Rat   512 -RRIHTG-EKPFKCNTCGKTFRQSSSRIAHQRIHTGEKPYECNTCGKLFNYRSSLTNH 567

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 12/82 (15%)
vATP-synt_E 109..>244 CDD:304907 26/146 (18%)
RRF <161..222 CDD:294170 10/72 (14%)
zf-C2H2_8 454..530 CDD:292531 24/76 (32%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 11/25 (44%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 9/21 (43%)
C2H2 Zn finger 571..591 CDD:275368 5/20 (25%)
C2H2 Zn finger 598..617 CDD:275368 8/18 (44%)
Zfp354aNP_434685.1 KRAB 14..74 CDD:214630 5/28 (18%)
KRAB 14..53 CDD:279668 3/7 (43%)
COG5048 170..567 CDD:227381 102/472 (22%)
Nuclear localization signal 170..189 2/19 (11%)
C2H2 Zn finger 190..210 CDD:275368 4/20 (20%)
zf-H2C2_2 202..227 CDD:290200 4/25 (16%)
C2H2 Zn finger 218..238 CDD:275368 0/20 (0%)
zf-H2C2_2 230..254 CDD:290200 4/33 (12%)
C2H2 Zn finger 246..266 CDD:275368 3/20 (15%)
zf-H2C2_2 258..281 CDD:290200 6/23 (26%)
C2H2 Zn finger 274..294 CDD:275368 4/38 (11%)
C2H2 Zn finger 327..347 CDD:275368 2/40 (5%)
zf-H2C2_2 339..364 CDD:290200 6/30 (20%)
C2H2 Zn finger 355..375 CDD:275368 5/38 (13%)
zf-H2C2_2 367..392 CDD:290200 7/39 (18%)
C2H2 Zn finger 383..403 CDD:275368 5/21 (24%)
C2H2 Zn finger 411..431 CDD:275368 5/20 (25%)
zf-H2C2_2 424..448 CDD:290200 8/30 (27%)
C2H2 Zn finger 439..459 CDD:275368 5/20 (25%)
zf-H2C2_2 451..476 CDD:290200 11/25 (44%)
C2H2 Zn finger 467..487 CDD:275368 6/20 (30%)
zf-H2C2_2 479..502 CDD:290200 9/23 (39%)
C2H2 Zn finger 495..515 CDD:275368 9/21 (43%)
zf-H2C2_2 507..532 CDD:290200 10/27 (37%)
C2H2 Zn finger 523..543 CDD:275368 5/20 (25%)
zf-H2C2_2 539..560 CDD:290200 8/21 (38%)
C2H2 Zn finger 551..571 CDD:275368 8/18 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.