DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp937

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001135883.1 Gene:Zfp937 MGIID:3644476 Length:503 Species:Mus musculus

Alignment Length:385 Identity:109/386 (28%)
Similarity:151/386 (39%) Gaps:95/386 (25%)


  Fly   277 EEEFILGCNTDPANNS---DVNID--------GLELDEEVPAESGEDFREINMVGSDVVHTDNGE 330
            :||:.|   .||:..:   ||.::        |...::..|.|..:..|.            :|.
Mouse    15 QEEWAL---LDPSQKNLYRDVMLETYRNLAAIGYSWEDHNPEEHFQSSRR------------HGR 64

  Fly   331 IYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQF-SGEKPEEIED-----VVVFNL---- 385
            :       .:...::...||.|...:.:|.....|..|. :||||.|.|.     |....|    
Mouse    65 L-------EKSHIEEKPSEFTQCGKVIAYQSHPQGHQQIHTGEKPYECEQCGKSFVCQSGLQQHK 122

  Fly   386 ----GE---EISQEQQVFSF------HENVIIVEK--EQNDRDE----QTPL---KRKRSSELVF 428
                ||   |.:|..:.|:.      |:.:...||  |.|..|:    ||.|   ||..|.|   
Mouse   123 RTHHGEKSYECNQCDKAFALLCHLRGHQRIHTGEKPYECNQCDKAFACQTSLLYHKRTHSGE--- 184

  Fly   429 KQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLS 493
                              |.:.|:.|..||..|..|..|..||......|      |..|....:
Mouse   185 ------------------KLYVCNECGKAFVLQSYLQIHKRTHTGEKPFG------CDQCDKAFA 225

  Fly   494 CASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHI 558
            ..|.|..|...|||.|||.|.:|:.:|:|...|..|..||||.|...|.||...|||.|:|..| 
Mouse   226 QNSHLLTHKRTHTGEKPFGCDQCDKAFAQNSHLLTHKRTHTGEKPFGCDQCDKAFAQNSHLLTH- 289

  Fly   559 GRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTT 617
            .|.|.| .:.::|..|.::|...|||.:|..||.|.. :.|||||:.|..:|.:|:|..|
Mouse   290 KRTHTG-EKPYECKQCGKAFGFQSGLQKHKRTHTGEKPYECKQCGKAFGYQSGLQKHKRT 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 26/76 (34%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 11/25 (44%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 12/24 (50%)
C2H2 Zn finger 541..562 CDD:275368 10/21 (48%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 9/19 (47%)
Zfp937NP_001135883.1 KRAB 4..57 CDD:214630 10/45 (22%)
KRAB 4..43 CDD:279668 7/31 (23%)
C2H2 Zn finger 78..97 CDD:275368 4/19 (21%)
COG5048 86..486 CDD:227381 94/293 (32%)
zf-H2C2_2 93..114 CDD:290200 8/21 (38%)
C2H2 Zn finger 105..125 CDD:275368 3/20 (15%)
zf-H2C2_2 118..141 CDD:290200 6/23 (26%)
C2H2 Zn finger 133..153 CDD:275368 3/20 (15%)
zf-H2C2_2 145..170 CDD:290200 6/25 (24%)
C2H2 Zn finger 161..181 CDD:275368 7/20 (35%)
C2H2 Zn finger 189..209 CDD:275368 8/20 (40%)
C2H2 Zn finger 217..237 CDD:275368 5/20 (25%)
C2H2 Zn finger 245..265 CDD:275368 7/20 (35%)
C2H2 Zn finger 273..293 CDD:275368 10/21 (48%)
zf-H2C2_2 285..308 CDD:290200 7/25 (28%)
C2H2 Zn finger 301..321 CDD:275368 8/20 (40%)
zf-H2C2_2 314..338 CDD:290200 11/24 (46%)
C2H2 Zn finger 329..349 CDD:275368 10/21 (48%)
zf-H2C2_2 342..366 CDD:290200 3/8 (38%)
C2H2 Zn finger 357..377 CDD:275368
zf-H2C2_2 369..393 CDD:290200
C2H2 Zn finger 385..405 CDD:275368
zf-H2C2_2 397..422 CDD:290200
C2H2 Zn finger 413..433 CDD:275368
C2H2 Zn finger 441..461 CDD:275368
zf-H2C2_2 453..476 CDD:290200
C2H2 Zn finger 469..488 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.