DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zscan4c

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001013787.1 Gene:Zscan4c MGIID:2685243 Length:506 Species:Mus musculus

Alignment Length:383 Identity:97/384 (25%)
Similarity:145/384 (38%) Gaps:56/384 (15%)


  Fly   228 SLDGSE---PETKP--QVKEDASPSRSKTKALPKRRPSLVDA---NLKATEARKDAKEEEFILGC 284
            |:.|.|   .|..|  :|.:.....:|.|:..|......||.   .|.||  .::..|.|....|
Mouse   129 SMQGQEALFSENMPLKEVIKLLKQQQSATRPTPDNEQMPVDTTQDRLLAT--GQENSENECNNSC 191

  Fly   285 NTDPANNSDVNIDGLELDE--EVPAESGEDFREINMV------------GSDVVHTDNGEIYIIN 335
            |...||..: :..|.|:|.  .:..|...:..|.|:|            |:...|.|........
Mouse   192 NATEANVGE-SCSGNEMDSLLIIQKEQHPEHEEGNVVCQFPHGARRASQGTPSHHVDFPSAPTTA 255

  Fly   336 SASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQ-FSGEK-PEEIEDVVVFN---------LGE-- 387
            ....|:|.:|.:.|...::....||...:...| :||:. |....|.:..|         :|:  
Mouse   256 DVPMEEQPKDLSRENISEDKNNCYNTSRNAATQVYSGDNIPRNKSDSLFINKRIYHPEPEVGDIP 320

  Fly   388 -EISQEQQVFSFHENVIIVEK-----EQNDRDEQTPLKRKRS---SELVF---KQESSCP-QPKT 439
             .:.|:....|...:..:.|.     .:||..|...|:.::.   |:.|.   ..|::.| :...
Mouse   321 YGVPQDSTRASQGTSTCLQESLGECFSENDPREVPGLQSRQEQPISDPVLLGKNHEANLPCESHQ 385

  Fly   440 GRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMII 504
            .|.....|.::|..|...|...:.|:.|..||:     .|...|.|.:|.......|..:.|.||
Mouse   386 KRFCRDAKLYKCEECSRMFKHARSLSSHQRTHL-----NKKSELLCVTCQKMFKRVSDRRTHEII 445

  Fly   505 HTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVH 562
            |...||||||.||.|||.:..||.|...|||...:.|..||..|.|.|...:|:...|
Mouse   446 HMPEKPFKCSTCEKSFSHKTNLKSHEMIHTGEMPYVCSLCSRRFRQSSTYHRHLRNYH 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 6/21 (29%)
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 29/76 (38%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 15/25 (60%)
C2H2 Zn finger 513..533 CDD:275368 10/20 (50%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
Zscan4cNP_001013787.1 SCAN <51..117 CDD:295388
zf-C2H2 395..417 CDD:278523 6/22 (27%)
C2H2 Zn finger 397..417 CDD:275368 6/20 (30%)
C2H2 Zn finger 426..446 CDD:275368 6/20 (30%)
zf-H2C2_2 438..463 CDD:290200 15/25 (60%)
C2H2 Zn finger 454..474 CDD:275368 10/20 (50%)
zf-H2C2_2 466..491 CDD:290200 10/25 (40%)
C2H2 Zn finger 482..500 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.