DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp58

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001007576.1 Gene:Zfp58 MGIID:99205 Length:489 Species:Mus musculus

Alignment Length:321 Identity:84/322 (26%)
Similarity:129/322 (40%) Gaps:87/322 (27%)


  Fly   360 NIKEDGEIQFSGEKPEEIEDV-VVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRS 423
            |:.|...|. :||||.:.|:. ..|.:..::|..|:|.:                .:.|.|.:..
Mouse   120 NLSEHKRIH-TGEKPYKCEECGKAFRIRSKLSTHQRVHT----------------GEKPYKCEEC 167

  Fly   424 SELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSC 488
            .: .|...|:..:.|  ||....|.::|..|..||.|:....||...|     :|| ...||..|
Mouse   168 GK-AFNSHSNLSEHK--RIHTGEKPYKCEECGKAFSTRSTYYRHQKNH-----TGK-KPYKCEEC 223

  Fly   489 ALQLS----------------------------CASSLKRHMIIHTGLKPFKCSECELSFSQREV 525
            |.:.|                            |...||:|.|||:..||:||:||..:|....:
Mouse   224 AKEFSYPSLLKVHQRIHSAEKSYKCEECGKPFYCPLLLKKHQIIHSAEKPYKCAECGKAFHYPSL 288

  Fly   526 LKRHMDTHTG------------------VKRHQ----------CPQCSSCFAQKSNLQQHIGRVH 562
            ||||...|.|                  :||||          |.:|...|....:||.| .|.|
Mouse   289 LKRHQRIHAGKKPCKCKDCDRAFYSSAFLKRHQRIHSEENSYKCGECGKRFCSFPHLQYH-QRFH 352

  Fly   563 MGNSRTHKCHLCHRSFNHVSGLSRHLVTHAG-VMFSCKQCGRQFNDRSAVQRHVTTMHKVK 622
            .| .:.:||..|.::|:.:|.|..|.:.|:| ..:.|::||:.|.....:::| ..:|:.|
Mouse   353 SG-EKPYKCEQCGKTFSTLSYLPWHKLRHSGEKSYKCEKCGKMFYSTLDLKKH-QKIHEYK 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 32/104 (31%)
C2H2 Zn finger 485..505 CDD:275368 10/48 (21%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 8/20 (40%)
zf-H2C2_2 526..550 CDD:290200 13/52 (25%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
Zfp58NP_001007576.1 KRAB 2..61 CDD:214630
KRAB 2..41 CDD:279668
C2H2 Zn finger 80..100 CDD:275368
COG5048 106..489 CDD:227381 84/322 (26%)
C2H2 Zn finger 108..128 CDD:275368 3/8 (38%)
zf-H2C2_2 120..143 CDD:290200 8/24 (33%)
C2H2 Zn finger 136..156 CDD:275368 5/20 (25%)
zf-H2C2_2 149..173 CDD:290200 6/41 (15%)
C2H2 Zn finger 164..184 CDD:275368 5/23 (22%)
zf-H2C2_2 176..201 CDD:290200 8/27 (30%)
C2H2 Zn finger 192..212 CDD:275368 7/20 (35%)
C2H2 Zn finger 220..240 CDD:275368 4/20 (20%)
C2H2 Zn finger 248..268 CDD:275368 6/20 (30%)
C2H2 Zn finger 276..296 CDD:275368 8/20 (40%)
C2H2 Zn finger 304..324 CDD:275368 4/20 (20%)
C2H2 Zn finger 332..352 CDD:275368 7/21 (33%)
zf-H2C2_2 344..369 CDD:290200 10/27 (37%)
C2H2 Zn finger 360..380 CDD:275368 6/20 (30%)
C2H2 Zn finger 388..408 CDD:275368 5/21 (24%)
C2H2 Zn finger 412..432 CDD:275368 84/322 (26%)
zf-H2C2_2 424..449 CDD:290200
C2H2 Zn finger 440..460 CDD:275368
C2H2 Zn finger 468..488 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.