DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp454

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_011247281.1 Gene:Zfp454 MGIID:2679253 Length:571 Species:Mus musculus

Alignment Length:621 Identity:134/622 (22%)
Similarity:236/622 (38%) Gaps:161/622 (26%)


  Fly    35 LSIPVRLM--ACVALDAKATDTLPKRIC------QECRYQ------LEKSFLF----------RQ 75
            ||:...|:  .|..:.....|:.|:..|      ::|...      .:.:.||          .|
Mouse     7 LSLNTSLLQETCEMIQESCGDSQPELFCGMPRLVRKCSVSQDLVTFKDVAVLFTQEEWGQLSSAQ 71

  Fly    76 RCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWREDFK 140
            |..:.:..|..:..|:.||    :....||             .|..::: |.:...|:..|.|.
Mouse    72 RALYQDVMLENYSNLVSLG----LLGSQPD-------------MFFPLEE-VEECVSEEAPEGFV 118

  Fly   141 EEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKE 205
            .:.|.|.|.. .:|..|.:..:|.|:...::::.   ::.::.|:           |..:.|.||
Mouse   119 LDAADEPHLG-PRSACEAQVPVTGEITVAMSKKF---LKADIPEK-----------ESDQWIAKE 168

  Fly   206 QLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQV-KEDASPSRSKTKALPKRRPSLVDANLKAT 269
            :....|            ..|:..:|.|.:.:..| .:..:||:...:.:.....|.:.:  :.:
Mouse   169 RACANL------------FNWQCQEGQEVKLQQVVLTQQNTPSKLSEQRVRAESSSPIQS--QRS 219

  Fly   270 EARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDF-REINMVGSDVVHTDNGEIYI 333
            :|.|.|.|      |                      :|.|:.| :...:.....:||:.     
Mouse   220 QASKTAFE------C----------------------SECGKAFSKSSTLKKHQKLHTEK----- 251

  Fly   334 INSASSEDQNQDSTPEFDQDNGITSYNIKEDGEI------------QFSGEKPEEIEDVVVFNLG 386
            :|.:......:            ..|..:|.|:.            ..:||||.:.:|     .|
Mouse   252 LNPSQKSPMKE------------KRYKCRECGKAFHQSTHLIHHQRVHTGEKPYQCKD-----CG 299

  Fly   387 EEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFK--QESSCPQPKTGRITDTVKSF 449
            :..|....: |:|:.:...||         |.:.....:...:  ..|...:..||.     |.|
Mouse   300 KAFSVSSSL-SYHQKIHTGEK---------PFECNVCGKAFIRNIHLSHHHRMHTGE-----KPF 349

  Fly   450 QCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCS 514
            ||:||..||..:..||:|.:.|     ||| ...||..|....:.::|..:|..||||.|||:|:
Mouse   350 QCNLCDKAFVCRAHLTKHQHIH-----SGK-KPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECN 408

  Fly   515 ECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFN 579
            ||..:|.....|..|...|||.|.:||.:|...|...|:..:| .::|.| .:.::|.||.::|.
Mouse   409 ECGKAFRVNSSLTEHQRIHTGEKPYQCIECGKAFRDNSSFARH-RKIHTG-EKPYRCGLCEKAFR 471

  Fly   580 HVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRH 614
            ..|.|::|..||.|.. ::|..|.:.|:|.||:.:|
Mouse   472 DQSALAQHQRTHTGEKPYTCNICEKAFSDHSALTQH 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 13/75 (17%)
vATP-synt_E 109..>244 CDD:304907 22/136 (16%)
RRF <161..222 CDD:294170 8/61 (13%)
zf-C2H2_8 454..530 CDD:292531 28/76 (37%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 5/21 (24%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 7/18 (39%)
Zfp454XP_011247281.1 KRAB 50..102 CDD:214630 11/69 (16%)
KRAB 50..89 CDD:279668 6/39 (15%)
C2H2 Zn finger 228..248 CDD:275368 4/42 (10%)
COG5048 232..567 CDD:227381 85/322 (26%)
C2H2 Zn finger 267..287 CDD:275368 2/20 (10%)
zf-H2C2_2 279..303 CDD:290200 6/29 (21%)
C2H2 Zn finger 295..315 CDD:275368 5/26 (19%)
zf-H2C2_2 307..332 CDD:290200 5/35 (14%)
C2H2 Zn finger 323..343 CDD:275368 1/20 (5%)
zf-H2C2_2 335..360 CDD:290200 11/30 (37%)
C2H2 Zn finger 351..371 CDD:275368 8/20 (40%)
zf-H2C2_2 363..388 CDD:290200 10/31 (32%)
C2H2 Zn finger 379..399 CDD:275368 5/20 (25%)
zf-H2C2_2 391..414 CDD:290200 12/23 (52%)
C2H2 Zn finger 407..427 CDD:275368 6/20 (30%)
zf-H2C2_2 419..442 CDD:290200 9/23 (39%)
C2H2 Zn finger 435..455 CDD:275368 5/21 (24%)
zf-H2C2_2 447..470 CDD:290200 6/25 (24%)
C2H2 Zn finger 463..483 CDD:275368 8/20 (40%)
zf-H2C2_2 475..499 CDD:290200 8/24 (33%)
C2H2 Zn finger 491..511 CDD:275368 7/18 (39%)
zf-H2C2_2 503..528 CDD:290200 2/6 (33%)
C2H2 Zn finger 519..539 CDD:275368
zf-H2C2_2 531..556 CDD:290200
C2H2 Zn finger 547..567 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.