DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp612

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_006530970.1 Gene:Zfp612 MGIID:2443465 Length:735 Species:Mus musculus

Alignment Length:572 Identity:132/573 (23%)
Similarity:214/573 (37%) Gaps:140/573 (24%)


  Fly   149 KRLVKSRLELRAKLTTELRKELAEEVRSE--------------VRKELAEEVRSQVRDDLRNEVS 199
            |..|.|:||.|..|  |...:||....|:              :.||:.||.:|.: .:|:.:.|
Mouse   119 KPAVISQLEERKDL--ENLFQLATGTDSQGLWTECTAVQSGNNLTKEVHEEEKSTL-FELQKDFS 180

  Fly   200 EDIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETK---------PQVKEDASPSR----SKT 251
            ::....:..:|..:.|:.....:.|...:.||....:.         ||:.:|.:.|.    |.|
Mouse   181 QETNFSKTYILGQQQEIRSAGSERGSASATDGRAKASSVEGCLFSQTPQLSQDHTSSTGELYSDT 245

  Fly   252 KALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLE--LDEEVP---AESGE 311
            |.....|.:..:..||..|..:               |:.....::.|.  .|.|.|   ||.|:
Mouse   246 KLSKSERITTEERPLKPRELAE---------------ASQGSPQVNQLPEICDVEKPYQCAECGK 295

  Fly   312 DFR-EINMVGSDVVHTDNGE----------------IYI----INSASSEDQNQDSTPEFDQDNG 355
            .|. :...|....:|  |||                .||    |:|.....|.:.....|..:..
Mouse   296 AFSVKAKFVWHQRLH--NGEKPFKCVECGKCFSYSSHYITHQTIHSGEKPYQCKVCGKAFSVNGS 358

  Fly   356 ITSYNIKEDGEIQF----------------------SGEKPEEIEDV-VVFNLGEEISQEQQVFS 397
            :..:.....||..:                      :||||.|..|. ..||:..::.|.|::.:
Mouse   359 LVRHQRIHTGEKPYQCKDCGAGFGCSSAYITHQRTHTGEKPYECSDCGKAFNVNAKLIQHQRIHT 423

  Fly   398 ---------------------FHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGR 441
                                 .|:::...||..  |..:......::::|:..|          |
Mouse   424 GEKPYECDVCGKGFRCSTQLRQHQSIHTGEKPH--RCSECGKGFTKNAKLIQHQ----------R 476

  Fly   442 ITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHT 506
            :....|.:.|..|...|..:..|.:|...|     :|: ...:|..|.....|.|.|::|:.|||
Mouse   477 VHTGEKPYACSDCGKTFSAKGKLIQHQRIH-----TGE-RPYECSECGKSFRCNSQLRQHLRIHT 535

  Fly   507 GLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKC 571
            |.||:|||||..:|:....|.:|..||||.|..:|.:|..||..|.||..| .|.|.| .:.::|
Mouse   536 GEKPYKCSECGKAFNVNAKLMQHRRTHTGEKPFECKECGKCFTSKRNLLDH-QRAHTG-EKPYQC 598

  Fly   572 HLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRS--AVQRHVTTMHK 620
            ..|.::|:..:.|:||...|.... |.|.:|.:.|:..|  .|.:.:.|..|
Mouse   599 SECGKAFSINAKLTRHQQIHTREKPFKCMECEKAFSCSSDYIVHQRIHTGEK 650

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 26/118 (22%)
RRF <161..222 CDD:294170 14/75 (19%)
zf-C2H2_8 454..530 CDD:292531 26/76 (34%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 14/25 (56%)
C2H2 Zn finger 513..533 CDD:275368 8/20 (40%)
zf-H2C2_2 526..550 CDD:290200 11/24 (46%)
C2H2 Zn finger 541..562 CDD:275368 9/21 (43%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 5/21 (24%)
Zfp612XP_006530970.1 KRAB 74..134 CDD:214630 8/17 (47%)
KRAB 74..113 CDD:279668
C2H2 Zn finger 290..310 CDD:275368 5/20 (25%)
COG5048 314..720 CDD:227381 84/358 (23%)
C2H2 Zn finger 318..338 CDD:275368 3/20 (15%)
zf-H2C2_2 333..354 CDD:290200 4/21 (19%)
C2H2 Zn finger 346..366 CDD:275368 1/20 (5%)
zf-H2C2_2 358..381 CDD:290200 2/23 (9%)
C2H2 Zn finger 374..394 CDD:275368 0/20 (0%)
zf-H2C2_2 389..410 CDD:290200 7/21 (33%)
C2H2 Zn finger 402..422 CDD:275368 5/20 (25%)
zf-H2C2_2 415..439 CDD:290200 2/24 (8%)
C2H2 Zn finger 430..450 CDD:275368 1/20 (5%)
zf-H2C2_2 443..466 CDD:290200 4/25 (16%)
C2H2 Zn finger 458..478 CDD:275368 3/30 (10%)
zf-H2C2_2 471..494 CDD:290200 7/33 (21%)
C2H2 Zn finger 486..506 CDD:275368 5/20 (25%)
zf-H2C2_2 499..523 CDD:290200 6/30 (20%)
C2H2 Zn finger 514..534 CDD:275368 7/20 (35%)
zf-H2C2_2 527..550 CDD:290200 14/23 (61%)
C2H2 Zn finger 542..562 CDD:275368 8/20 (40%)
zf-H2C2_2 555..579 CDD:290200 11/24 (46%)
C2H2 Zn finger 570..590 CDD:275368 9/21 (43%)
zf-H2C2_2 582..606 CDD:290200 9/26 (35%)
C2H2 Zn finger 598..618 CDD:275368 6/20 (30%)
zf-H2C2_2 611..635 CDD:290200 8/24 (33%)
C2H2 Zn finger 626..646 CDD:275368 5/20 (25%)
zf-H2C2_2 641..662 CDD:290200 3/11 (27%)
C2H2 Zn finger 654..674 CDD:275368
zf-H2C2_2 666..690 CDD:290200
C2H2 Zn finger 682..702 CDD:275368
C2H2 Zn finger 710..730 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.