DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp940

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_776099.1 Gene:Zfp940 MGIID:2446235 Length:566 Species:Mus musculus

Alignment Length:536 Identity:131/537 (24%)
Similarity:188/537 (35%) Gaps:145/537 (27%)


  Fly   168 KELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVY------LTEKKAGRW 226
            :::|.:...|..:.|:.:.||..||.:....|.        ::...|.||      |.||....|
Mouse     9 RDVAVDFSPEEWECLSLDQRSLYRDVMLESYSH--------LVSVGLFVYRPHLFSLLEKGQDPW 65

  Fly   227 ESLDGSEPETK-PQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPAN 290
            ..|   ..||: |....|.|....|....|.....|....:|  |..:....|:|..|...|..|
Mouse    66 MIL---RDETRGPYPDIDFSSQNKKFLGKPSTYEELSQREMK--EYFRKRSLEDFCFGDGWDGKN 125

  Fly   291 ------NSD--------------VNIDGLELDEEVPAESGEDFREIN-----MVGSD-------- 322
                  |.:              || .|:..:......:||...||.     .|.||        
Mouse   126 QFQTHQNQEYFKQLAVAYEKVLTVN-QGIVFNNHQRLNAGEKATEIQCEKALTVESDRILPQLTP 189

  Fly   323 ---VVHTDNGEIYIINSASSE-------------DQNQDSTPEFDQDNGI----------TSYNI 361
               .||.|. |....::..||             .|.::|...|...:||          .||:.
Mouse   190 PGNKVHKDK-ECGDTSAPESERTHCQRAHCPQTPQQGKESGGPFGLPSGILGLPQGHTGEKSYDC 253

  Fly   362 KEDGEIQF-------------SGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRD 413
            ||.|: .|             :||:|     ......|:..:|:..:.| |:.:           
Mouse   254 KECGK-SFTLKSNLTRHRRIHTGERP-----YTCHGCGKAFTQKSHLMS-HQKI----------- 300

  Fly   414 EQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSG 478
                                    .||:     |::.|.:|..||.....||.|.|.|.....:|
Mouse   301 ------------------------HTGK-----KAYVCGVCGKAFHCDSSLTSHQNIHYHAADAG 336

  Fly   479 KGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQ 543
            | ...:|..|.....|.|.|..|..:|||.|||||..|...|.....|:.|...|:|||.:.|.:
Mouse   337 K-KAYECKKCGKDFDCHSGLIDHQKVHTGEKPFKCKHCGRLFRFHSHLRAHTRIHSGVKSYDCKE 400

  Fly   544 CSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAG-VMFSCKQCGRQFND 607
            |...|..:|||.:| .|||.| .|.:.||.|.::|:..|.|:.|...|.| ..:.|..||:.|:.
Mouse   401 CGKSFNLRSNLMRH-HRVHTG-ERPYTCHGCGKAFSQKSHLTSHQKIHTGEKAYVCGVCGKAFSR 463

  Fly   608 RSAVQRHVTTMHKVKN 623
            .|::..|....:.|.|
Mouse   464 GSSLTSHQNIHYYVVN 479

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 20/83 (24%)
RRF <161..222 CDD:294170 14/60 (23%)
zf-C2H2_8 454..530 CDD:292531 28/76 (37%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 5/20 (25%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 9/21 (43%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
Zfp940NP_776099.1 KRAB 6..66 CDD:214630 15/65 (23%)
KRAB 6..45 CDD:279668 8/44 (18%)
COG5048 <249..437 CDD:227381 65/238 (27%)
zf-C2H2 251..273 CDD:278523 5/23 (22%)
C2H2 Zn finger 253..273 CDD:275368 4/21 (19%)
zf-H2C2_2 265..290 CDD:290200 4/30 (13%)
C2H2 Zn finger 281..301 CDD:275368 4/56 (7%)
zf-H2C2_2 293..318 CDD:290200 9/66 (14%)
C2H2 Zn finger 309..329 CDD:275368 8/20 (40%)
C2H2 Zn finger 342..357 CDD:275370 5/15 (33%)
COG5048 <366..524 CDD:227381 42/117 (36%)
C2H2 Zn finger 370..390 CDD:275368 5/20 (25%)
zf-H2C2_2 382..406 CDD:290200 9/24 (38%)
C2H2 Zn finger 398..418 CDD:275368 9/21 (43%)
zf-H2C2_2 410..435 CDD:290200 12/27 (44%)
C2H2 Zn finger 426..446 CDD:275368 7/20 (35%)
zf-H2C2_2 438..463 CDD:290200 8/25 (32%)
C2H2 Zn finger 454..474 CDD:275368 6/20 (30%)
C2H2 Zn finger 487..507 CDD:275368
zf-H2C2_2 499..522 CDD:290200
C2H2 Zn finger 515..535 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.