DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp85

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001001130.1 Gene:Zfp85 MGIID:107767 Length:473 Species:Mus musculus

Alignment Length:282 Identity:86/283 (30%)
Similarity:124/283 (44%) Gaps:43/283 (15%)


  Fly   370 SGEKPEEIEDV-VVFNLGEEISQEQQVFSFHE-----------NV-IIVEKEQNDRDEQTPLKRK 421
            :||||.:.|:. ..|::|..:|..|::.:..:           || .::.|.|.....:.|.|.|
Mouse   188 TGEKPYKCEECGKAFSVGTTLSNHQRIHTGEKPYKCEECGMAFNVRFLLSKHQQTHTGEKPYKCK 252

  Fly   422 RSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGK----GGT 482
            ...: .|...||..|.:  :|....|.::|..|..||.....|.:|...| .|:|..|    |.|
Mouse   253 ECGK-AFNCSSSLHQHQ--QIHRGEKLYKCDDCGQAFSCSSYLYKHRRIH-TGMKPSKCKECGKT 313

  Fly   483 L-------------------KCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKR 528
            .                   ||..|....|..|...:|..||:|.||:||.|||.:|:....|.:
Mouse   314 FYCSVNLIYHQRIHTGEKPYKCNECGKAFSIYSRFMKHQRIHSGEKPYKCKECEKAFNNCYNLIQ 378

  Fly   529 HMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAG 593
            |...|||.|.::|..|...|...|:|.|| .|:|.| .:.:||..|.::||..|.|..|...|.|
Mouse   379 HQRIHTGEKPYKCKDCGKAFHYTSSLAQH-ERIHTG-EKPYKCEECGKAFNSSSNLKNHWRLHTG 441

  Fly   594 VM-FSCKQCGRQFNDRSAVQRH 614
            .. :.|:|||:.|.|.|:..||
Mouse   442 EKPYKCEQCGKAFKDCSSFTRH 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 30/99 (30%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 9/18 (50%)
Zfp85NP_001001130.1 KRAB 5..65 CDD:214630
KRAB 5..44 CDD:279668
COG5048 79..464 CDD:227381 86/283 (30%)
C2H2 Zn finger 83..103 CDD:275368
zf-H2C2_2 96..120 CDD:290200
C2H2 Zn finger 111..131 CDD:275368
zf-H2C2_2 123..148 CDD:290200
C2H2 Zn finger 139..159 CDD:275368
C2H2 Zn finger 167..187 CDD:275368
zf-H2C2_2 180..203 CDD:290200 6/15 (40%)
C2H2 Zn finger 195..215 CDD:275368 5/20 (25%)
zf-H2C2_2 208..231 CDD:290200 2/23 (9%)
C2H2 Zn finger 223..243 CDD:275368 4/20 (20%)
zf-H2C2_2 236..260 CDD:290200 6/25 (24%)
C2H2 Zn finger 251..271 CDD:275368 6/23 (26%)
C2H2 Zn finger 279..299 CDD:275368 6/20 (30%)
C2H2 Zn finger 307..327 CDD:275368 2/20 (10%)
zf-H2C2_2 319..343 CDD:290200 3/24 (13%)
C2H2 Zn finger 335..355 CDD:275368 6/20 (30%)
zf-H2C2_2 348..372 CDD:290200 12/24 (50%)
C2H2 Zn finger 363..383 CDD:275368 7/20 (35%)
zf-H2C2_2 375..400 CDD:290200 9/25 (36%)
C2H2 Zn finger 391..411 CDD:275368 8/21 (38%)
zf-H2C2_2 403..428 CDD:290200 11/27 (41%)
C2H2 Zn finger 419..439 CDD:275368 7/20 (35%)
C2H2 Zn finger 447..467 CDD:275368 9/18 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.