DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Gm4767

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_011241947.1 Gene:Gm4767 MGIID:3644409 Length:578 Species:Mus musculus

Alignment Length:440 Identity:109/441 (25%)
Similarity:169/441 (38%) Gaps:94/441 (21%)


  Fly   254 LPKRRPSLV-------DANLKATEARKDAKEEEFILGCNTDPA---------NNSDVNIDGLELD 302
            :|.||.:..       |..|:|:.|.: :.|..|..|.|..||         .:|.|: ..|..|
Mouse     1 MPTRRSAYCVQEKCKDDFTLRASLANQ-SLEAHFSGGGNIRPAILRFDCESEGSSSVS-RALRCD 63

  Fly   303 EEVPA--ESGE-DFREINMVG-SDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKE 363
            ..:.|  .:|| ..|.::.|. .||......|.:.:...|.:...:|...|..::.....|.:::
Mouse    64 RLLGAVRRAGELGIRAMDAVTYEDVYVKFTHEEWALLDPSQKSLYKDVMLETCRNLTAIGYKLQD 128

  Fly   364 D------------GEIQFSGEKPEE----------IEDVVVFNLGEEISQEQQVFSFHE------ 400
            |            |.....|.||.|          ..........|.|..|::.:..::      
Mouse   129 DNIEEHCPSSRGCGRYNIYGYKPCEHKGYGKKQCTFAQKRFLQTYERICSEEKPYECNQCSKAFA 193

  Fly   401 NVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSC---PQPKTGRITDTVKSFQCHLCPVAFPTQK 462
            |...::|.:.:...:.|.:.....: .|...|:.   .:..||.     |.|.|..|..||....
Mouse   194 NFRSLQKHEKNHTREKPYECNHCGK-AFPSRSALQIHQRTHTGE-----KPFDCSECGKAFARHS 252

  Fly   463 LLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLK 527
            .|..|..|| .|.|     ...|..|....|..|.|:.|.|||||.||:.|::|..:|:.|..|:
Mouse   253 NLDIHKRTH-TGEK-----PYDCNECGKAFSTRSHLQIHEIIHTGEKPYVCNQCGKAFAYRSNLE 311

  Fly   528 RHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMG---------------------NSRTHK- 570
            .|..||||.|.::|.||.:.:|.:|:|:.| .:.|.|                     :.|||. 
Mouse   312 AHEKTHTGEKPYECNQCGNVYASRSSLRNH-EKHHTGEKLYGCNQCGKAFARRSSLEIHERTHTG 375

  Fly   571 -----CHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRH 614
                 |:.|.::|...|.|..|..:|.|.. :.|.|||:.|..|:::|.|
Mouse   376 EKPYVCNQCCKAFARRSSLQIHERSHTGEKPYECNQCGKAFASRTSLQNH 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 28/76 (37%)
C2H2 Zn finger 485..505 CDD:275368 8/20 (40%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 11/24 (46%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 8/18 (44%)
Gm4767XP_011241947.1 KRAB 83..>127 CDD:214630 8/44 (18%)
KRAB 83..122 CDD:279668 7/39 (18%)
COG5048 181..537 CDD:227381 71/259 (27%)
C2H2 Zn finger 185..205 CDD:275368 2/20 (10%)
zf-H2C2_2 197..220 CDD:290200 2/24 (8%)
C2H2 Zn finger 213..233 CDD:275368 2/21 (10%)
zf-H2C2_2 225..250 CDD:290200 8/30 (27%)
C2H2 Zn finger 241..261 CDD:275368 7/20 (35%)
zf-H2C2_2 253..278 CDD:290200 9/31 (29%)
C2H2 Zn finger 269..289 CDD:275368 8/20 (40%)
zf-H2C2_2 281..306 CDD:290200 12/25 (48%)
C2H2 Zn finger 297..317 CDD:275368 7/20 (35%)
C2H2 Zn finger 325..345 CDD:275368 7/21 (33%)
C2H2 Zn finger 353..373 CDD:275368 2/20 (10%)
zf-H2C2_2 365..390 CDD:290200 6/25 (24%)
C2H2 Zn finger 381..401 CDD:275368 6/20 (30%)
zf-H2C2_2 393..418 CDD:290200 9/25 (36%)
C2H2 Zn finger 409..429 CDD:275368 8/18 (44%)
C2H2 Zn finger 437..457 CDD:275368
zf-H2C2_2 449..474 CDD:290200
C2H2 Zn finger 465..485 CDD:275368
C2H2 Zn finger 493..513 CDD:275368
zf-H2C2_2 505..530 CDD:290200
C2H2 Zn finger 521..541 CDD:275368
zf-H2C2_2 533..558 CDD:290200
C2H2 Zn finger 549..569 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.