DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and ZBTB7C

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_011524163.1 Gene:ZBTB7C HGNCID:31700 Length:668 Species:Homo sapiens

Alignment Length:377 Identity:82/378 (22%)
Similarity:136/378 (36%) Gaps:125/378 (33%)


  Fly   327 DNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQ 391
            |.||         ||..:|...:.|.|:        |:.|.:...|:.::.:|...|...|.:..
Human   181 DGGE---------EDDKEDDDDDEDDDD--------EEDEEEEEEEEEDDDDDTEDFADQENLPD 228

  Fly   392 EQQVFSFHENVI----IVEKEQNDRDEQTP------------LKRKRSSELVFKQ----ESSCPQ 436
            .|.: |.|::..    :.||..:|.....|            :.|..|.|.:.::    :::.|.
Human   229 PQDI-SCHQSPSKTDHLTEKAYSDTPRDFPDSFQAGSPGHLGVIRDFSIESLLRENLYPKANIPD 292

  Fly   437 PKTGRITDTVKSFQCHLCPVAF------PTQ-------KLLTRHHN------------------- 469
            .:.. ::.....|..||.|..|      |.|       .|:.::..                   
Human   293 RRPS-LSPFAPDFFPHLWPGDFGAFAQLPEQPMDSGPLDLVIKNRKIKEEEKEELPPPPPPPFPN 356

  Fly   470 ---------------------------------THIKGL----------KSGKGGTLKCPSCALQ 491
                                             ||:.||          |.....:.:||.|...
Human   357 DFFKDMFPDLPGGPLGPIKAENDYGAYLNFLSATHLGGLFPPWPLVEERKLKPKASQQCPICHKV 421

  Fly   492 LSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQ 556
            :..|..|.|||..|||.||:.|:.||:.|::::.||.||..|||.:.:.|..|::.|....:|:.
Human   422 IMGAGKLPRHMRTHTGEKPYMCTICEVRFTRQDKLKIHMRKHTGERPYLCIHCNAKFVHNYDLKN 486

  Fly   557 HIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVMFSCKQC----GRQ 604
            |: |:|.| .|.::|..|::||.....|.||:...     ||:..    ||:
Human   487 HM-RIHTG-VRPYQCEFCYKSFTRSDHLHRHIKRQ-----SCRMARPRRGRK 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 30/151 (20%)
C2H2 Zn finger 485..505 CDD:275368 8/20 (40%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 8/20 (40%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 3/12 (25%)
ZBTB7CXP_011524163.1 BTB 73..176 CDD:279045
BTB 84..177 CDD:197585
C2H2 Zn finger 415..435 CDD:275368 8/20 (40%)
zf-H2C2_2 430..452 CDD:290200 12/22 (55%)
C2H2 Zn finger 443..463 CDD:275368 8/20 (40%)
zf-H2C2_2 456..480 CDD:290200 10/24 (42%)
C2H2 Zn finger 471..491 CDD:275368 6/21 (29%)
zf-H2C2_2 483..508 CDD:290200 10/27 (37%)
C2H2 Zn finger 499..517 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.