DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp184

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_898835.1 Gene:Zfp184 MGIID:1922244 Length:737 Species:Mus musculus

Alignment Length:619 Identity:147/620 (24%)
Similarity:230/620 (37%) Gaps:177/620 (29%)


  Fly   114 FEDSIAFIEVQDKVRKLEDEKWR------EDFKEEQAAEMHKRLVK-----------SRLELRAK 161
            |.:|:.|   :|.|.....|:|:      .|...:...|.:..||.           |:||...:
Mouse    24 FRESVTF---KDVVVNFTQEEWKHLDPIQRDLFRDVTLENYTHLVSIGLQVSKPDMISQLEQGTE 85

  Fly   162 LTTE-----------LRKELAEEVRSEVRKELAEE-------VRSQVRDDLRNEVSEDIRKEQLA 208
            ..||           .:|.....| |.:..:::||       |.:..|||      ..:.|.|..
Mouse    86 PWTEDSCIPVGPLEDWKKRAGNSV-SSLELDISEEHLFSETVVTNSKRDD------GSLEKLQAN 143

  Fly   209 MLLGELEVYLTEKKAGRWES-LDGSE---PETKPQVKEDASPSRSKTKALPKRRPSLVDANL--K 267
            ..:...||.:|||.|...|| |..|.   .:|:..:.:.::.:|:|..:.|.::..|...|.  |
Mouse   144 QQMLPREVQITEKTAPTCESNLSVSSSFITQTEVALDQPSTKTRAKQNSHPVKKEKLCKCNECGK 208

  Fly   268 A--------TEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDF-REINMVGSDV 323
            |        ...|....|:.:  .||                      |..:.| |..|::....
Mouse   209 AFTYCSALIRHQRTHTGEKPY--KCN----------------------ECNKAFSRSENLINHQR 249

  Fly   324 VHTDN--------GEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGE--------IQ---- 368
            :||.:        |:.:|...:.::.|...:        |...|...|.|:        :|    
Mouse   250 IHTGDKPYKCDQCGKGFIEGPSLTQHQRIHT--------GEKPYKCDECGKAFSQRTHLVQHQRI 306

  Fly   369 FSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRK-------RSSEL 426
            .:||||....:     .|:..||... |..|:.:...||         |.|.:       ||:.|
Mouse   307 HTGEKPYTCTE-----CGKSFSQRGH-FMEHQKIHTGEK---------PFKCEECEKTFTRSTHL 356

  Fly   427 VFKQE----------SSCPQPKTG--------RITDTVKSFQCHLCPVAFPTQKLLTRHHNTH-- 471
            ...|:          :.|.:...|        .|....|.::|:.|..||.....||:|..||  
Mouse   357 TQHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYECNECGKAFSQHSNLTQHQKTHTG 421

  Fly   472 -------------------IKGLKSGKG-GTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSEC 516
                               .:.||...| ...||..|....|..|||.:|..|||..|||:||||
Mouse   422 EKPYDCAECGKAFSYWSSLAQHLKIHTGEKPYKCSDCGKAFSYCSSLTQHRRIHTREKPFECSEC 486

  Fly   517 ELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHV 581
            ..:||....|.:|..|||..|.::|.:|...|.:.|:|.:| .|:|.| .:.::||.|.::|::.
Mouse   487 GKAFSYLSNLNQHQKTHTQEKAYECKECGKAFIRSSSLAKH-ERIHTG-EKPYQCHECGKTFSYG 549

  Fly   582 SGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRH 614
            |.|.:|...|.|.. :.|.:|||.||.:..:.:|
Mouse   550 SSLIQHKKIHTGERPYKCNECGRAFNQKIHLTQH 583

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 38/169 (22%)
RRF <161..222 CDD:294170 18/79 (23%)
zf-C2H2_8 454..530 CDD:292531 33/98 (34%)
C2H2 Zn finger 485..505 CDD:275368 8/20 (40%)
zf-H2C2_2 497..522 CDD:290200 15/25 (60%)
C2H2 Zn finger 513..533 CDD:275368 9/20 (45%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 7/18 (39%)
Zfp184NP_898835.1 KRAB 28..88 CDD:214630 12/63 (19%)
KRAB 28..67 CDD:279668 9/42 (21%)
COG5048 163..634 CDD:227381 113/471 (24%)
C2H2 Zn finger 203..223 CDD:275368 4/20 (20%)
zf-H2C2_2 215..240 CDD:290200 6/49 (12%)
C2H2 Zn finger 231..251 CDD:275368 6/42 (14%)
zf-H2C2_2 243..266 CDD:290200 4/23 (17%)
C2H2 Zn finger 259..279 CDD:275368 3/20 (15%)
zf-H2C2_2 271..296 CDD:290200 5/33 (15%)
C2H2 Zn finger 287..307 CDD:275368 3/20 (15%)
zf-H2C2_2 299..324 CDD:290200 7/30 (23%)
C2H2 Zn finger 315..335 CDD:275368 5/26 (19%)
zf-H2C2_2 327..352 CDD:290200 6/35 (17%)
C2H2 Zn finger 343..363 CDD:275368 4/20 (20%)
zf-H2C2_2 355..379 CDD:290200 3/24 (13%)
C2H2 Zn finger 371..391 CDD:275368 3/20 (15%)
zf-H2C2_2 386..408 CDD:290200 6/22 (27%)
C2H2 Zn finger 399..419 CDD:275368 8/20 (40%)
zf-H2C2_2 411..436 CDD:290200 5/25 (20%)
C2H2 Zn finger 427..447 CDD:275368 2/20 (10%)
zf-H2C2_2 439..464 CDD:290200 7/25 (28%)
C2H2 Zn finger 455..475 CDD:275368 8/20 (40%)
zf-H2C2_2 467..492 CDD:290200 15/25 (60%)
C2H2 Zn finger 483..503 CDD:275368 9/20 (45%)
zf-H2C2_2 495..520 CDD:290200 9/25 (36%)
C2H2 Zn finger 511..531 CDD:275368 7/21 (33%)
zf-H2C2_2 523..548 CDD:290200 9/27 (33%)
C2H2 Zn finger 539..559 CDD:275368 7/20 (35%)
zf-H2C2_2 551..576 CDD:290200 10/25 (40%)
C2H2 Zn finger 567..587 CDD:275368 7/18 (39%)
zf-H2C2_2 579..604 CDD:290200 1/6 (17%)
C2H2 Zn finger 595..615 CDD:275368
zf-H2C2_2 607..632 CDD:290200
C2H2 Zn finger 623..643 CDD:275368
zf-H2C2_2 636..659 CDD:290200
C2H2 Zn finger 651..671 CDD:275368
C2H2 Zn finger 679..698 CDD:275368
C2H2 Zn finger 706..726 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.