DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and klf-3

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001022205.1 Gene:klf-3 WormBaseID:WBGene00003480 Length:315 Species:Caenorhabditis elegans

Alignment Length:267 Identity:57/268 (21%)
Similarity:88/268 (33%) Gaps:87/268 (32%)


  Fly   304 EVPAESGED---FREINMVGSDVVHTDNGEIYIINSASSEDQNQ-----DSTPEFDQDNGITSYN 360
            :||..|..:   :.|:..|.:..:|:.....:.|.:..|..:|.     ...|....:  |..:.
 Worm   122 DVPTTSDRNPPYYTEVTTVSAVTLHSMTPPTHKIETPPSSPENSFGPLASQLPAIKME--IPMHP 184

  Fly   361 IKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSE 425
            :..:||:..:...|                                 ......|::||:||.   
 Worm   185 LPHNGELDSTRSSP---------------------------------SSTTSSERSPLQRKS--- 213

  Fly   426 LVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCAL 490
               :.||:...|       |.|.|..|.|..                             |.|..
 Worm   214 ---RIESNKRNP-------TDKKFVVHACTY-----------------------------PGCFK 239

  Fly   491 QLSCASSLKRHMIIHTGLKPFKC--SECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSN 553
            :.|.:|.||.|...|:|.|||.|  ..|...|::.:.|.|||..|||.|..:|..|...||:..:
 Worm   240 KYSKSSHLKAHERTHSGEKPFVCKWQNCSWKFARSDELTRHMRKHTGDKPFRCSLCDRNFARSDH 304

  Fly   554 LQQHIGR 560
            |..|:.|
 Worm   305 LSLHMKR 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 19/78 (24%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 11/27 (41%)
C2H2 Zn finger 513..533 CDD:275368 7/22 (32%)
zf-H2C2_2 526..550 CDD:290200 12/24 (50%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
klf-3NP_001022205.1 C2H2 Zn finger 235..254 CDD:275368 7/19 (37%)
C2H2 Zn finger 262..284 CDD:275368 7/22 (32%)
zf-H2C2_2 276..301 CDD:290200 12/25 (48%)
C2H2 Zn finger 292..312 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.