DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and LOC102556967

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_006223302.1 Gene:LOC102556967 RGDID:7510716 Length:727 Species:Rattus norvegicus

Alignment Length:530 Identity:124/531 (23%)
Similarity:200/531 (38%) Gaps:144/531 (27%)


  Fly   184 EEVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSR 248
            ||||.:.|.:...::..|:...|:...||      .|::.|..|.|...:..|....:|:.....
  Rat     9 EEVRDRPRLETTEDMPTDMNFCQMPQRLG------AEEQDGPCERLVSFDDVTVDFSQEEWQHLD 67

  Fly   249 SKTKALPKRRPSLVDANLKAT-EARKDAKEEEFILGCN--TDPANNSDVN------IDGLELDEE 304
            |..:.|.:.....:.::|.|. :.:.|.:.::..:..:  ||..|....:      ::.|..|::
  Rat    68 SAQRCLYQEVMLEIYSHLLAVGKLQLDIQHQQIFVKASFLTDATNEVTRHGSCCSVLEKLWQDDD 132

  Fly   305 VPAE----------SGEDFREINMVGSDVV--HTDNGEIYIINSASSEDQNQDSTPEFDQDNGIT 357
            ..|:          |.:.||...::..|.|  :.:.||.::|::       |...|..:.||   
  Rat   133 TAAKRDQQSQVRPISPDAFRNQKLLNIDSVCDYEETGEPHLIST-------QYVPPRANSDN--- 187

  Fly   358 SYNIKEDGEIQFSGEKPEEIEDVV----VFNLG-----------EEISQEQQVFS--FHENVIIV 405
                        .....|::.|::    .|..|           .|.|..:..|.  ...|:.::
  Rat   188 ------------QSNTIEQLNDIIGSHQCFTQGSSNDICTVPPQREKSYNESQFGNILSPNLPLM 240

  Fly   406 EKEQNDRDE---QTPLKRKRSSELVFKQESSCPQPKTGRITDTVK-SFQCHLCPVAFPTQKLLTR 466
            :.|.|.:|:   .|...:..:.|:||     |.|    :||:.:: ||.||.|...|..:..|..
  Rat   241 DHEINFQDKPVGYTGCGKVFTGEVVF-----CEQ----QITNNMETSFICHTCGKTFLHKSKLAS 296

  Fly   467 HHNTHIKGLKSGKGGTLKCPSCA--------LQLSC--------------------ASSLKRHMI 503
            |..||      .:....:||.||        ||:.|                    .|.||.|:.
  Rat   297 HSETH------REETPYECPDCAKSRRGKSSLQVLCGIQTKEKPYECHVCGKSFSYTSHLKVHLR 355

  Fly   504 IHTGLKPFKCSECELSFSQREV----------------------------LKRHMDTHTGVKRHQ 540
            .|||.||:.||:|..:|||:.|                            |.:|...|||.|.::
  Rat   356 THTGEKPYACSDCGKAFSQKSVLTIHQRIHTGEKPYTCSDCGKMFVCASDLTKHCRFHTGEKPYE 420

  Fly   541 CPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHA-GVMFSCKQCGRQ 604
            ||.|...|:.||||..| .|:|.... .:||..|..||..:|.|..|...|. |..|.|..||..
  Rat   421 CPDCGKSFSIKSNLLAH-HRIHTSEG-PYKCFDCGESFRKISQLKVHHQIHTDGRSFVCSDCGMA 483

  Fly   605 FNDRSAVQRH 614
            |:.:|.:..|
  Rat   484 FSQKSVLTTH 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 15/60 (25%)
RRF <161..222 CDD:294170 10/38 (26%)
zf-C2H2_8 454..530 CDD:292531 31/132 (23%)
C2H2 Zn finger 485..505 CDD:275368 11/48 (23%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 9/48 (19%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 10/21 (48%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 6/18 (33%)
LOC102556967XP_006223302.1 KRAB 49..>89 CDD:214630 6/40 (15%)
KRAB 49..88 CDD:279668 6/39 (15%)
C2H2 Zn finger 254..273 CDD:275368 8/28 (29%)
C2H2 Zn finger 281..301 CDD:275368 7/20 (35%)
COG5048 328..702 CDD:227381 50/169 (30%)
zf-C2H2 335..357 CDD:278523 4/22 (18%)
C2H2 Zn finger 337..357 CDD:275368 4/20 (20%)
zf-H2C2_2 349..374 CDD:290200 13/25 (52%)
C2H2 Zn finger 365..385 CDD:275368 7/20 (35%)
zf-H2C2_2 378..402 CDD:290200 0/24 (0%)
C2H2 Zn finger 393..413 CDD:275368 2/20 (10%)
zf-H2C2_2 405..429 CDD:290200 10/24 (42%)
C2H2 Zn finger 421..441 CDD:275368 10/21 (48%)
C2H2 Zn finger 449..469 CDD:275368 7/20 (35%)
C2H2 Zn finger 477..497 CDD:275368 6/18 (33%)
C2H2 Zn finger 505..525 CDD:275368
zf-H2C2_2 517..541 CDD:290200
C2H2 Zn finger 533..553 CDD:275368
zf-C2H2 559..581 CDD:278523
C2H2 Zn finger 561..581 CDD:275368
zf-H2C2_2 573..598 CDD:290200
C2H2 Zn finger 589..609 CDD:275368
zf-H2C2_2 601..625 CDD:290200
C2H2 Zn finger 617..637 CDD:275368
C2H2 Zn finger 645..665 CDD:275368
zf-H2C2_2 657..681 CDD:290200
C2H2 Zn finger 673..693 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.