DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Znf354b

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_006220716.1 Gene:Znf354b RGDID:7562538 Length:625 Species:Rattus norvegicus

Alignment Length:652 Identity:157/653 (24%)
Similarity:240/653 (37%) Gaps:153/653 (23%)


  Fly    52 TDTL-PKRICQECRYQLEKSF-----LFRQRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDED 110
            |:|: |.:  :|.:.|:..:|     || .|.:|  ||       |.|.:||.        |.|.
  Rat    22 TETMAPDK--REGKSQVSVTFEDVAVLF-TRDEW--KK-------LDLSQRSL--------YREV 66

  Fly   111 ELEFEDSIA---FIEVQDK---VRKLEDEKWREDFKEEQAAEMHKRLVKSRLELRAKLTTELRKE 169
            .||...::|   |...:.|   |.:..:|.|:.: ||....        |.|...:.|.|....:
  Rat    67 MLENYSNLASLGFPFTKPKMISVLQQGEEPWKAE-KESHGC--------SSLGCNSSLQTTKSTQ 122

  Fly   170 LAEEVRSEV-RKELAEE------VRSQVRDDLRNEVSEDIRKEQLAML-LGELEVYLTEKKAGRW 226
            ..|....|: ||:|..:      .....|.|  |...:..:.|.|.:: :...::...:|....:
  Rat   123 TKESSFQELKRKQLKRDEDWDFTSGKSCRPD--NSFKKQNKNESLQIISITHTKILTVDKSHKNF 185

  Fly   227 ESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANN 291
            |.  |.....|...|:..:..:::..:|.:...||....:|..|.|         ..|:|    .
  Rat   186 EF--GPSVSLKSISKQKIAREKTQRNSLKENSTSLNQPKIKTLEKR---------FKCST----C 235

  Fly   292 SDVNIDGLELDEEVPAESGED-------FREINMVGSDVVH--TDNGE-IYIINSASSEDQNQDS 346
            ....|....|.:.:...|||.       .:..:...:.:.|  |..|| .||.|.......:..|
  Rat   236 EKAFIHSSSLRKHLKNHSGERLFQCKDCLKAFSQSSALIQHQRTHTGEKPYICNECGKAFSHSAS 300

  Fly   347 TPEFDQDNGI-TSYNIKEDGE------IQFSGEKPEEIEDVVVFNLGEEISQE----QQVFS--- 397
            ..:..:.:.: .||..||.|:      ..|..:|....|:...:|.|.:.|..    |:..|   
  Rat   301 LCKHLRTHTLEKSYTCKECGKSFSRRSSLFLHQKIHARENPHRYNPGRKASASLSGCQRAHSRKK 365

  Fly   398 ------------------FHENVIIVEKEQNDRDEQTPLKRKRSSEL--VFKQESSCPQPKTGRI 442
                              :|:.:...||         |.   |.||.  .|.|.:|..|.:  ||
  Rat   366 TYLCNECGNTFKSSSSLRYHQRIHTGEK---------PF---RCSECGRAFSQSASLIQHE--RI 416

  Fly   443 TDTVKSFQCHLCPVAFPTQKLLTRHHNTHI-----------KGLKSGKGGTL------------- 483
            ....|.::|..|...|.:...|.||...|.           |.|.|  ..||             
  Rat   417 HTGEKPYRCGECGKGFTSISRLNRHRIIHTGEKLYNCNECGKALSS--HSTLIIHERIHTGEKPC 479

  Fly   484 KCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCF 548
            ||..|......:|:|.:|..:|||.:|:||:||..:|.....|..|...|||.|.:||.:|...|
  Rat   480 KCKVCGKAFRQSSALIQHQRMHTGERPYKCNECGKTFRCNSSLSNHQRIHTGEKPYQCIECGMSF 544

  Fly   549 AQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQ 612
            .|.:.|.|| .|:|.| .:..||:.|.|||...|.|..|...|.|.. :.|..||:.|:.||::.
  Rat   545 GQSAALIQH-QRIHTG-EKPFKCNTCGRSFRQSSSLIAHQRIHTGEKPYECSACGKLFSQRSSLT 607

  Fly   613 RH 614
            .|
  Rat   608 NH 609

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 12/40 (30%)
vATP-synt_E 109..>244 CDD:304907 30/149 (20%)
RRF <161..222 CDD:294170 13/69 (19%)
zf-C2H2_8 454..530 CDD:292531 28/100 (28%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 11/25 (44%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 7/18 (39%)
Znf354bXP_006220716.1 zf-H2C2_2 549..574 CDD:290200 12/27 (44%)
C2H2 Zn finger 565..585 CDD:275368 8/20 (40%)
zf-H2C2_2 577..602 CDD:290200 8/25 (32%)
C2H2 Zn finger 593..613 CDD:275368 7/18 (39%)
KRAB 38..97 CDD:214630 20/77 (26%)
KRAB 38..77 CDD:279668 16/57 (28%)
COG5048 206..609 CDD:227381 109/434 (25%)
C2H2 Zn finger 232..252 CDD:275368 4/24 (17%)
zf-H2C2_2 244..269 CDD:290200 4/25 (16%)
C2H2 Zn finger 260..280 CDD:275368 2/20 (10%)
zf-H2C2_2 272..297 CDD:290200 7/25 (28%)
C2H2 Zn finger 288..308 CDD:275368 2/20 (10%)
zf-C2H2 314..336 CDD:278523 6/22 (27%)
C2H2 Zn finger 316..336 CDD:275368 5/20 (25%)
C2H2 Zn finger 369..389 CDD:275368 1/20 (5%)
zf-H2C2_2 381..406 CDD:290200 8/37 (22%)
C2H2 Zn finger 397..417 CDD:275368 8/22 (36%)
zf-H2C2_2 409..434 CDD:290200 8/27 (30%)
C2H2 Zn finger 425..445 CDD:275368 6/20 (30%)
C2H2 Zn finger 453..473 CDD:275368 5/22 (23%)
zf-H2C2_2 466..490 CDD:290200 4/24 (17%)
C2H2 Zn finger 481..501 CDD:275368 5/20 (25%)
zf-H2C2_2 493..518 CDD:290200 11/25 (44%)
C2H2 Zn finger 509..529 CDD:275368 6/20 (30%)
zf-H2C2_2 521..544 CDD:290200 9/23 (39%)
C2H2 Zn finger 537..557 CDD:275368 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.