DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and LOC100909688

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_017450699.1 Gene:LOC100909688 RGDID:6502425 Length:661 Species:Rattus norvegicus

Alignment Length:288 Identity:88/289 (30%)
Similarity:134/289 (46%) Gaps:42/289 (15%)


  Fly   349 EFDQDNGITSYNIKEDGEIQFSGEKPEEIE--DVVVFNLGEEISQEQQV------FSFHENVIIV 405
            |..||  :.|:.   |..|.||   |||.|  :...:||.:|:..|...      .:|.:..::.
  Rat    11 ELTQD--LLSFT---DVAIDFS---PEECECLEPAQWNLYKEVMLENYSNLLFLGLAFSKPYLVT 67

  Fly   406 EKEQ-----NDRDEQTPLKRKRSSELVFKQESSCPQP--------KTGRITDTVKSFQCHLCPVA 457
            ..||     |.::..|......|...:||:   |.:.        :..:|....|.:.|..|..:
  Rat    68 CLEQRKEPWNVKEPATVAVYPGSKPYIFKE---CGKTFPWNSLLIQHHKIHPGAKLYTCDECGKS 129

  Fly   458 FPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQ 522
            |..:..|.:||.|| .|.|     ..||..|....:|:|||.:|..||||.||:|| ||..:|:.
  Rat   130 FNVRSTLYKHHRTH-TGEK-----PYKCKECGKAFTCSSSLNQHHRIHTGEKPYKC-ECGKAFNN 187

  Fly   523 REVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRH 587
            ...|.:|...|||.:.::|.:|...|...|...:| .|:|.| .|.:||..|.::||..:.||:|
  Rat   188 SSALTQHQRIHTGERPYKCDECGKAFNNCSARTRH-QRIHTG-ERPYKCAQCGKTFNFPTSLSQH 250

  Fly   588 LVTHAGVM-FSCKQCGRQFNDRSAVQRH 614
            ...|.|.. :.|::||:.||:.||:.:|
  Rat   251 QRIHTGEKPYKCEECGKAFNNCSALTQH 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 30/76 (39%)
C2H2 Zn finger 485..505 CDD:275368 8/20 (40%)
zf-H2C2_2 497..522 CDD:290200 14/25 (56%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 8/24 (33%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 8/18 (44%)
LOC100909688XP_017450699.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.