DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb7b

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_002944012.1 Gene:zbtb7b XenbaseID:XB-GENE-5727011 Length:387 Species:Xenopus tropicalis

Alignment Length:382 Identity:84/383 (22%)
Similarity:122/383 (32%) Gaps:147/383 (38%)


  Fly   195 RNEVSEDIRKEQLAMLLGE---LEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPK 256
            |.|:..|  .|.|...|..   ||.|:.::        :|......||.  |:.|.......:|.
 Frog   134 REEMGGD--AEDLECFLRARQYLECYMAQE--------NGESAALSPQA--DSPPPHPHNIPVPP 186

  Fly   257 RRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGS 321
            :...::        .|:..|:   .|..|.:..|:                 :|..||    |..
 Frog   187 KSVQII--------PRRGRKK---FLQVNPNRRNH-----------------NGSPFR----VAD 219

  Fly   322 DVVHTDNGEIYIINSAS-SEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNL 385
            |::..|.|....::.|| ...:...|...:..|||:       .|:..|....|.|         
 Frog   220 DLLDRDGGHAEALSPASVPPGEPHLSYERYAADNGL-------GGQTIFVPPSPPE--------- 268

  Fly   386 GEEISQEQ---QVFSFHENVIIVEKEQNDRDEQTP------------LKRKRSSELVFKQESSCP 435
             |.:|.|:   .||            ||..|.:.|            |.|||.|:|        |
 Frog   269 -EILSDEETSDMVF------------QNPYDPENPELVASGLDGADKLVRKRRSQL--------P 312

  Fly   436 QPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKR 500
            |                                               :||.|...:..|..|.|
 Frog   313 Q-----------------------------------------------ECPVCHKIIHGAGKLPR 330

  Fly   501 HMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQH 557
            ||..|||.|||.|..|.:.|::.:.||.||..|||.:.:.|..||:.|....:|:.|
 Frog   331 HMRTHTGEKPFVCQVCGVRFTRNDKLKIHMRKHTGERPYCCEHCSARFLHSYDLKNH 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 13/52 (25%)
RRF <161..222 CDD:294170 9/30 (30%)
zf-C2H2_8 454..530 CDD:292531 20/76 (26%)
C2H2 Zn finger 485..505 CDD:275368 8/20 (40%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 11/24 (46%)
C2H2 Zn finger 541..562 CDD:275368 6/18 (33%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
zbtb7bXP_002944012.1 BTB 24..129 CDD:279045
BTB 35..128 CDD:197585
COG5048 312..>381 CDD:227381 30/116 (26%)
C2H2 Zn finger 315..335 CDD:275368 8/20 (40%)
zf-H2C2_2 330..352 CDD:290200 12/22 (55%)
C2H2 Zn finger 343..363 CDD:275368 7/20 (35%)
zf-H2C2_2 356..380 CDD:290200 11/24 (46%)
C2H2 Zn finger 371..387 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.