DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and znf238.2

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_002940762.1 Gene:znf238.2 XenbaseID:XB-GENE-1219066 Length:505 Species:Xenopus tropicalis

Alignment Length:403 Identity:101/404 (25%)
Similarity:141/404 (35%) Gaps:106/404 (26%)


  Fly   218 LTEKKAGRWESL--DGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEF 280
            |.||:....|.:  |||:.|     |:|| |:.|:     :.....|:|..|...|..|      
 Frog   146 LKEKELNLGEKIGDDGSDLE-----KDDA-PTDSE-----EHHQHSVEAASKLKIATPD------ 193

  Fly   281 ILGCNTDPANNSDVN-IDGLELD----EEVPAE-------------------SGEDFREIN---- 317
                |..|.....|: :.||..|    ..||||                   |....|..|    
 Frog   194 ----NVKPIWKEKVSGLSGLSSDLIGVNSVPAEAVTCKTAAGKTKANGNSPSSPLSHRSANHTQP 254

  Fly   318 --------------MVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEI- 367
                          |.|.|..|..    |:.....|:.|.|.:.|....:..:.|.  :||.|. 
 Frog   255 PSDRDGALDLSFKPMPGRDSFHPS----YVFGQLVSDSQQQGTLPLVKDEQDLLSE--QEDSEAK 313

  Fly   368 ----QFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKE-QNDRDEQTPLKRKRSSELV 427
                |..|...:.:    |..||       .:|:.:.|....|.: ..||||..  ....||:| 
 Frog   314 SPKSQHVGNSAKSL----VTGLG-------HMFTGNGNSHAREDDLYQDRDESE--DEMDSSDL- 364

  Fly   428 FKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGK------GGTLKCP 486
                     ..:|.:....:...|.||...||:..:|..|.::|.:...:.:      |....|.
 Frog   365 ---------STSGVLVSPGQICICPLCSKVFPSPHVLQLHLSSHFRDRDNSRIKMSPDGSVPTCT 420

  Fly   487 SCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQK 551
            .|....||..:||||...|:|.||:.|.:|..||.....|.||...||..|.|.|..|...|.|.
 Frog   421 ICGKTFSCMYTLKRHERTHSGEKPYTCGQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQS 485

  Fly   552 SNLQQHIGRVHMG 564
            .:|.:||.:.|.|
 Frog   486 GDLYRHIRKFHCG 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 10/28 (36%)
RRF <161..222 CDD:294170 3/4 (75%)
zf-C2H2_8 454..530 CDD:292531 26/82 (32%)
C2H2 Zn finger 485..505 CDD:275368 8/20 (40%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
znf238.2XP_002940762.1 BTB 43..147 CDD:279045 1/1 (100%)
BTB 54..150 CDD:197585 3/4 (75%)
zf-C2H2_8 377..463 CDD:292531 27/86 (31%)
C2H2 Zn finger 379..399 CDD:275368 7/20 (35%)
C2H2 Zn finger 419..439 CDD:275368 8/20 (40%)
zf-H2C2_2 432..454 CDD:290200 11/22 (50%)
C2H2 Zn finger 447..467 CDD:275368 7/20 (35%)
C2H2 Zn finger 475..493 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.