DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb14

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_002938096.1 Gene:zbtb14 XenbaseID:XB-GENE-968315 Length:452 Species:Xenopus tropicalis

Alignment Length:582 Identity:127/583 (22%)
Similarity:208/583 (36%) Gaps:191/583 (33%)


  Fly    97 SRVFSKDPDDY--------DEDELEFE-DSIAFIEVQDKVRKLEDEKWREDFKEEQAAEMHKRLV 152
            |.....:.||:        :|..||.| ..||.:        :||.|:|.......|...:.:.:
 Frog     8 SETLKYNDDDHKTVFLKTLNEQRLEGEFCDIAIV--------VEDVKFRAHRCVLAACSTYFKKL 64

  Fly   153 KSRLELRAKLTTE---LRKELAEEVRSEV-RKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGE 213
            ..:||:.:....|   ||.::.|||.:.: ..::|                  ::||.:.:::..
 Frog    65 FKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKIA------------------VKKEDVNLMMSS 111

  Fly   214 ---LEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKAT----EA 271
               |.:...:|...:               |.|.| |..:..|.||.:.| .:.:||.|    ||
 Frog   112 GQILGIRFLDKLCSQ---------------KRDVS-SIDENPASPKNKYS-YETSLKITRPVGEA 159

  Fly   272 RKDAKEEEFILGCNTDPANNSDVNIDG--------------LELDEEVPAESG-EDFREINMVGS 321
            ..:..:|...:|...|  :.||..::|              |.:.|.:..|.| |:.|::|..|.
 Frog   160 NDNQDDEVEEIGDQDD--SPSDDTVEGTPQSHEEEKSPTSTLRVQEAILKELGSEEVRKVNCYGQ 222

  Fly   322 DVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLG 386
            :|                                                |..|..|.       
 Frog   223 EV------------------------------------------------EAMETTEP------- 232

  Fly   387 EEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQC 451
            :::..:.|..:|::::..|      :|||.|.....:|::.|                       
 Frog   233 KDLGSQTQTLTFNDSISEV------KDEQAPAWTTATSDMKF----------------------- 268

  Fly   452 HLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSEC 516
                     :.||..|..            ...|.:|....:..:.|::|..:||..:||.|..|
 Frog   269 ---------EYLLYGHRE------------QFACQACGKTFTDEARLRKHEKLHTADRPFVCEMC 312

  Fly   517 ELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHV 581
            ..:|:.:..||.|:..|||.|.:.|..|:..|.:..:|::| .||| .|.|...||||.::|.|.
 Frog   313 AKAFTTQAHLKEHLKIHTGYKPYSCEVCAKSFIRAPDLKKH-ERVH-SNERPFACHLCDKAFKHK 375

  Fly   582 SGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMHKVKNK--LTDYI-SETNEFQAVA 639
            |.|..|...|.|.. |.|..|.:.|...|.::||...||..:.|  .|..| |||.:.||.|
 Frog   376 SHLKDHERRHRGEKPFICASCTKAFAKASDLKRHENNMHSEQRKQVTTSAIQSETEQLQAAA 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 26/143 (18%)
RRF <161..222 CDD:294170 11/68 (16%)
zf-C2H2_8 454..530 CDD:292531 17/76 (22%)
C2H2 Zn finger 485..505 CDD:275368 4/20 (20%)
zf-H2C2_2 497..522 CDD:290200 9/25 (36%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 9/20 (45%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
zbtb14XP_002938096.1 BTB 26..129 CDD:279045 25/144 (17%)
BTB 37..128 CDD:197585 21/132 (16%)
C2H2 Zn finger 281..301 CDD:275368 4/20 (20%)
zf-H2C2_2 294..318 CDD:290200 9/24 (38%)
C2H2 Zn finger 309..329 CDD:275368 6/20 (30%)
zf-H2C2_2 321..346 CDD:290200 10/25 (40%)
C2H2 Zn finger 337..357 CDD:275368 7/21 (33%)
zf-H2C2_2 349..374 CDD:290200 12/27 (44%)
COG5048 361..>425 CDD:227381 23/64 (36%)
C2H2 Zn finger 365..385 CDD:275368 9/20 (45%)
zf-H2C2_2 377..401 CDD:290200 8/24 (33%)
C2H2 Zn finger 393..409 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.