DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb7c

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_004910395.1 Gene:zbtb7c XenbaseID:XB-GENE-954049 Length:585 Species:Xenopus tropicalis

Alignment Length:618 Identity:134/619 (22%)
Similarity:208/619 (34%) Gaps:160/619 (26%)


  Fly    30 EDDTQLSIPV----RLMACVALDAKATDTLPKRIC------QECRYQLEKSFLFRQRCQWAEKKL 84
            |||. :.||.    ..:.| .|:|:..|.|   :|      ||..|:..:|.|  ..|....|||
 Frog     5 EDDL-IGIPFPNHSSEVLC-GLNAQRQDGL---LCDVILIVQEQEYRTHRSVL--AACSQYFKKL 62

  Fly    85 RKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWREDFKEEQAAEMHK 149
            .....||.......:...:||.:.. .|||..:.........|:.:.|           ||||  
 Frog    63 FTAGSLLDQPYIYEIDFVEPDAFSA-ILEFAYTSTLTITASNVKHILD-----------AAEM-- 113

  Fly   150 RLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGEL 214
                  ||::..:...|  |:.|..|........||......||...|..:.:.:|...      
 Frog   114 ------LEIQCIINVCL--EILETPRDGEEDNEKEEDEDDDDDDDEEETKDFMNEENQT------ 164

  Fly   215 EVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEE 279
                         .:..|.....|...|.........|.||....|:  .|.....|.||...|.
 Frog   165 -------------DIQESSCHQSPPTSEQLEGHYESQKDLPTHFSSM--TNSTGQSAIKDFSIES 214

  Fly   280 FILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQ 344
             :|..|..|.:|         :.|..|..|       :.:.....|..||::...  |..::|.:
 Frog   215 -LLSENLYPKSN---------MAERRPTIS-------HFLPGFFPHLWNGDLGAF--AQLQEQPE 260

  Fly   345 DSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEI----------EDVVVFNLGEEISQEQQVFSFH 399
            |:.|   .|..|.:..|||        ||.:|:          ::|...:.|....|.:....:.
 Frog   261 DNGP---LDLVIKNRKIKE--------EKQDELPAPPFPNDFFKEVFAAHPGSHFGQIKAEMDYS 314

  Fly   400 ENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLL 464
            ..:..:...........||:.:|..           :||..:                       
 Frog   315 AYLSFLSAAHLGMFPPWPLEEERKL-----------KPKASQ----------------------- 345

  Fly   465 TRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRH 529
                               :||.|...:..|..|.|||..|||.||:.|:.||:.|::::.||.|
 Frog   346 -------------------QCPICHKVIMGAGKLPRHMRTHTGEKPYMCNICEVRFTRQDKLKIH 391

  Fly   530 MDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGV 594
            |..|||.:.:.|..|::.|....:|:.|: |:|.| .|.::|..|::||.....|.||:...   
 Frog   392 MRKHTGERPYLCIHCNAKFVHNYDLKNHM-RIHTG-VRPYQCEFCYKSFTRSDHLHRHIKRQ--- 451

  Fly   595 MFSCKQCGRQFNDRSAVQRHVTTMHKVKNKLTD 627
              ||:....:...:.|..|..:.|....|:..|
 Frog   452 --SCRMSRPRRGRKPAAWRTASLMFARNNRQED 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 20/66 (30%)
vATP-synt_E 109..>244 CDD:304907 24/135 (18%)
RRF <161..222 CDD:294170 10/61 (16%)
zf-C2H2_8 454..530 CDD:292531 20/76 (26%)
C2H2 Zn finger 485..505 CDD:275368 8/20 (40%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 8/20 (40%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 3/19 (16%)
zbtb7cXP_004910395.1 BTB 24..127 CDD:279045 31/130 (24%)
BTB 35..129 CDD:197585 27/118 (23%)
C2H2 Zn finger 347..367 CDD:275368 8/20 (40%)
zf-H2C2_2 362..384 CDD:290200 12/22 (55%)
C2H2 Zn finger 375..395 CDD:275368 8/20 (40%)
zf-H2C2_2 388..412 CDD:290200 10/24 (42%)
C2H2 Zn finger 403..423 CDD:275368 6/21 (29%)
zf-H2C2_2 415..440 CDD:290200 10/27 (37%)
C2H2 Zn finger 431..449 CDD:275368 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.