DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and si:zfos-932h1.3

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_021330860.1 Gene:si:zfos-932h1.3 ZFINID:ZDB-GENE-141222-4 Length:949 Species:Danio rerio

Alignment Length:210 Identity:63/211 (30%)
Similarity:91/211 (43%) Gaps:28/211 (13%)


  Fly   419 KRKRSSELVFKQESSCPQPKTGRITDTV-------------KSFQCHLCPVAFPTQKLLTRHHNT 470
            :|..|:..:::    |||  .|...||:             :..||..||.:|.....:.||..:
Zfish   647 RRSHSAAQLYR----CPQ--CGEAFDTLLQRSLHRQSHRPRQRHQCPQCPKSFTRSSDVRRHQLS 705

  Fly   471 HIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTG 535
            |     ||: ....|..|.......|.|.:|...|||.:|..|:.|..||:|..:|.||...|||
Zfish   706 H-----SGE-RPHHCTVCGKSFGLRSGLLKHQATHTGERPHCCTVCGKSFTQLSILLRHQRMHTG 764

  Fly   536 VKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCK 599
            .:.:.|.||...|.....|.:| .:.| ...|.|.|..|.:||.:...|..|::.|.||. :.|:
Zfish   765 ERPYLCSQCGKRFLSLGELLKH-DKTH-AEDRPHTCPQCPKSFKYKRALQEHMLAHTGVRPYPCR 827

  Fly   600 QCGRQFNDRSAVQRH 614
            .||:.|....|:.||
Zfish   828 YCGKMFAKPFALNRH 842

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 25/76 (33%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 10/25 (40%)
C2H2 Zn finger 513..533 CDD:275368 8/20 (40%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 7/18 (39%)
si:zfos-932h1.3XP_021330860.1 TIN2_N 23..199 CDD:240667
PAT1 <307..>439 CDD:330585
C2H2 Zn finger 545..565 CDD:275368
C2H2 Zn finger 573..593 CDD:275368
C2H2 Zn finger 601..619 CDD:275368
C2H2 Zn finger 658..678 CDD:275368 6/22 (27%)
COG5048 <679..861 CDD:227381 55/173 (32%)
C2H2 Zn finger 686..706 CDD:275368 6/20 (30%)
C2H2 Zn finger 714..734 CDD:275368 5/20 (25%)
C2H2 Zn finger 742..762 CDD:275368 8/20 (40%)
C2H2 Zn finger 770..790 CDD:275368 6/21 (29%)
C2H2 Zn finger 798..818 CDD:275368 6/20 (30%)
C2H2 Zn finger 826..846 CDD:275368 7/18 (39%)
C2H2 Zn finger 854..874 CDD:275368
zf-H2C2_2 866..891 CDD:316026
C2H2 Zn finger 882..902 CDD:275368
zf-H2C2_2 894..919 CDD:316026
C2H2 Zn finger 910..930 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.