DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb8b

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_012811945.1 Gene:zbtb8b XenbaseID:XB-GENE-5788421 Length:458 Species:Xenopus tropicalis

Alignment Length:386 Identity:84/387 (22%)
Similarity:132/387 (34%) Gaps:140/387 (36%)


  Fly   315 EINMVGSDVVHTDNGEIYI------------INSASSEDQNQDSTPEFDQ-DNGITSYNIKEDGE 366
            ::|:.|.:|:...:...|:            |.|:....:..:....|.| |:|....|...|.|
 Frog    87 KLNLCGENVIEVMSAASYLQMTDVVNFCKVFIRSSLDICRKIEKESSFGQADSGSDGLNSGRDAE 151

  Fly   367 IQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRD-EQTPLKRKRSS----EL 426
            :   |:.||                                ::||.| ::.|.:...||    ||
 Frog   152 L---GDSPE--------------------------------KENDSDCQKDPPRGDCSSCNSVEL 181

  Fly   427 VFKQ-------ESSCP----QPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHI----KGLK 476
            :.|.       ||..|    :||....:|.|:           .::.:.|.|..|.:    :||.
 Frog   182 LVKDHPTEGSPESKSPNKAVEPKEEFDSDVVE-----------VSEGVQTYHIPTDLEQGDEGLH 235

  Fly   477 SGKGGTLKCPSC-------ALQLSCASSLKRHMIIH----------------------------- 505
            :..|..:.|.:.       ||..:.:|..|...:.|                             
 Frog   236 AASGVDIACNNYHMKQFLEALLRNSSSQRKEDPVHHFPRDFESRQDEAGVPMSSMMDIQGDWYGE 300

  Fly   506 -TG------LKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHM 563
             ||      :|..||..|..:..|:.:||||:.:|||.:.:.|..|...|.::.:|:.|...||.
 Frog   301 ETGDVLVVPIKLHKCPFCPYTAKQKGILKRHIRSHTGERPYPCEICGKRFTRQEHLRSHALTVHR 365

  Fly   564 GNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVMFSCKQCGRQFNDRSAVQRHVTTMHKVKNK 624
            .| |...|..|.|:|  .|.||..| ...|:..|| .|             |||.|...|:
 Frog   366 SN-RPIICKGCRRTF--TSSLSPGL-RRFGLCDSC-TC-------------VTTTHDDSNQ 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 23/123 (19%)
C2H2 Zn finger 485..505 CDD:275368 5/27 (19%)
zf-H2C2_2 497..522 CDD:290200 8/61 (13%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 4/19 (21%)
zbtb8bXP_012811945.1 BTB 14..118 CDD:279045 4/31 (13%)
BTB 25..122 CDD:197585 6/35 (17%)
C2H2 Zn finger 315..335 CDD:275368 7/20 (35%)
zf-H2C2_2 328..352 CDD:290200 10/24 (42%)
C2H2 Zn finger 343..364 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.