DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and ZBTB42

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001131073.1 Gene:ZBTB42 HGNCID:32550 Length:422 Species:Homo sapiens

Alignment Length:120 Identity:42/121 (35%)
Similarity:55/121 (45%) Gaps:6/121 (5%)


  Fly   451 CHLCPVAFPTQKLLTRHHNTHIKGLKSGK------GGTLKCPSCALQLSCASSLKRHMIIHTGLK 509
            |.||...||:..:|..|.:.|.:...|.:      |....||.|....||..:||||...|:|.|
Human   296 CPLCSKLFPSSHVLQLHLSAHFRERDSTRARLSPDGVAPTCPLCGKTFSCTYTLKRHERTHSGEK 360

  Fly   510 PFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMG 564
            |:.|.:|..||.....|.||...||..|.|.|..|...|.|..:|.:|:.:.|.|
Human   361 PYTCVQCGKSFQYSHNLSRHTVVHTREKPHACRWCERRFTQSGDLYRHVRKFHCG 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 28/82 (34%)
C2H2 Zn finger 485..505 CDD:275368 9/20 (45%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
ZBTB42NP_001131073.1 BTB 14..114 CDD:279045
BTB 25..121 CDD:197585
COG5048 <292..>405 CDD:227381 38/109 (35%)
C2H2 Zn finger 296..316 CDD:275368 7/20 (35%)
C2H2 Zn finger 336..356 CDD:275368 9/20 (45%)
zf-H2C2_2 349..371 CDD:290200 11/22 (50%)
C2H2 Zn finger 364..384 CDD:275368 7/20 (35%)
zf-H2C2_2 376..401 CDD:290200 10/25 (40%)
C2H2 Zn finger 392..410 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.