DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and bcl6

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001116278.1 Gene:bcl6 XenbaseID:XB-GENE-984479 Length:702 Species:Xenopus tropicalis

Alignment Length:705 Identity:144/706 (20%)
Similarity:236/706 (33%) Gaps:218/706 (31%)


  Fly    14 CRLCLKEHQDAYAIFDEDDTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEKSFLFRQ--R 76
            |:..||..:|..|:....|..|  |.|.|.       ..|.:..|.|:    ..|.:..||.  .
 Frog   123 CQRFLKSSEDIVAMKPPRDEFL--PGRAML-------PPDVMAYRNCE----MSENTIPFRSGTM 174

  Fly    77 CQWAEKKLRKHIRLLGLGKRSRVFSKDPDDY-------------DEDELEFEDSIAFIEVQDKVR 128
            |.             |....|.::|.....|             .|||:                
 Frog   175 CD-------------GRSYLSSLYSSSTSSYPLYGHMPVPGFLFPEDEV---------------- 210

  Fly   129 KLEDEKWREDFKEEQAAEMHK--RLVKSRL---ELRAKLTTELRKELAE------EVRSEVRKEL 182
                       |:.|.:||.|  |..|.|:   |....|..:.||.:::      ...:..:|::
 Frog   211 -----------KDMQMSEMQKASRNQKERVLPGENSRTLLGDYRKVMSDMSFNMCHSNNYSQKDV 264

  Fly   183 A-EEVRSQVRDDLRNEVSEDIRKEQLAMLLGELEV--------YLTEKKAGRWESLDGSEPETKP 238
            | ||.||:...:               |::|....        :.|.:|..:.|....||.|...
 Frog   265 AMEEPRSEAHYN---------------MVIGSRSAGPSFRSSPFFTCEKTTKEEERTSSEDEISQ 314

  Fly   239 QVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNS----------- 292
            ..|...||:..|....| :.|...|....:......:|......|.::..:.||           
 Frog   315 HFKPTNSPANRKGLVSP-QSPQKSDCQPNSPTESSSSKNARISQGSSSPVSKNSTDPKACNWKKY 378

  Fly   293 ----------------DVNIDGL---------ELDEEVPAESGEDFREINMVGSDVVHTDNGEIY 332
                            ...||.|         .....|.:|:.:|.....:.||.       |..
 Frog   379 MMLSSLKQRDKESCTKQSEIDNLSPNSYTSLSSYQHPVKSENADDQASPKINGST-------EDP 436

  Fly   333 IINSASS----EDQNQDSTPEFDQDNG-----ITSYNIKEDGEIQFSGEKPEEI-EDVVVFNLGE 387
            :|..||.    .:::.:.:|:..:.:.     .:.:|:       ||.:.|.|: ......|.||
 Frog   437 LIPQASKLNNLVNRSLEGSPQSSEGHSPLYVHASKFNL-------FSSQSPPELCPHTPGSNFGE 494

  Fly   388 EISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCH 452
            ||::.|..:|                                 :|||   :.|       :|.|:
 Frog   495 EITETQSEYS---------------------------------DSSC---ENG-------TFFCN 516

  Fly   453 LCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECE 517
            .|...|..:..|.||.      |:.......||..|........:|..|..:|||.||::||.|.
 Frog   517 ECDSRFSEEGSLKRHM------LQVHSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCSICG 575

  Fly   518 LSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVS 582
            ..|::...||.|...|:|.|.::|..|.:.|.|.::|:.|: .:|.| .:.:.|.:|...|.|:.
 Frog   576 AQFNRPANLKTHTRIHSGEKPYKCETCGARFVQVAHLRAHV-LIHTG-EKPYPCEICGTRFRHLQ 638

  Fly   583 GLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMH-KVKNKLTDY-ISETNE 634
            .|..||..|.|.. :.|::|...|..:|.::.|:...| .:.|....| :|.:::
 Frog   639 TLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSSSSD 693

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 17/74 (23%)
vATP-synt_E 109..>244 CDD:304907 30/155 (19%)
RRF <161..222 CDD:294170 12/76 (16%)
zf-C2H2_8 454..530 CDD:292531 23/76 (30%)
C2H2 Zn finger 485..505 CDD:275368 4/20 (20%)
zf-H2C2_2 497..522 CDD:290200 11/25 (44%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
bcl6NP_001116278.1 BTB 24..128 CDD:279045 2/5 (40%)
BTB 35..131 CDD:197585 3/8 (38%)
C2H2 Zn finger 515..536 CDD:275368 7/27 (26%)
C2H2 Zn finger 543..563 CDD:275368 4/20 (20%)
zf-H2C2_2 555..580 CDD:290200 11/25 (44%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
zf-H2C2_2 583..608 CDD:290200 9/25 (36%)
C2H2 Zn finger 599..619 CDD:275368 6/21 (29%)
zf-H2C2_2 611..636 CDD:290200 7/27 (26%)
C2H2 Zn finger 627..647 CDD:275368 7/20 (35%)
zf-H2C2_2 640..664 CDD:290200 8/24 (33%)
C2H2 Zn finger 655..673 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.