DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb49

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001096409.1 Gene:zbtb49 XenbaseID:XB-GENE-992553 Length:542 Species:Xenopus tropicalis

Alignment Length:298 Identity:59/299 (20%)
Similarity:104/299 (35%) Gaps:91/299 (30%)


  Fly   337 ASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQ--EQQVFSFH 399
            ||:.|| .|..|..||.:|..:.:         .|:...:|..||..|:.:.::.  :|......
 Frog   294 ASNVDQ-VDGAPNVDQGDGAPNVD---------QGDGVPDINQVVAANVEQTVASNVDQTELPSV 348

  Fly   400 ENVIIVEKEQ---------NDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHL-- 453
            :..::...||         ::..|..|.....|..::...:|..|.|     .:.:.:|. |.  
 Frog   349 DLAVVPNVEQTVVPNVCADHNAIETHPWDLNHSEPILGPPDSLTPIP-----VEPLPAFS-HTFV 407

  Fly   454 -------CPVAFPTQKLLTRHHNTHIKGL------KSGKGGTLKCPSCALQLSCASSLKRHMIIH 505
                   .|:.||.|..|.:  ..|:|.|      |:.:|.:.  |...||              
 Frog   408 IHQDPEPLPLQFPEQMQLKK--AVHLKKLNILRSQKAAEGSSQ--PEAVLQ-------------- 454

  Fly   506 TGLKPFKCSECELSFSQREVL----KRHMDTHTGVKRHQCPQCSSCF------AQKSNLQQHIGR 560
                    |..|..:|:.:||    :.:.:...|         |..|      .:...::..:..
 Frog   455 --------STTEPVYSEGKVLEASDRGYWEKEAG---------SGIFEGLHENVEAERVESPLVP 502

  Fly   561 VHMGNSRTHK---CHLCHRSFNHVSGLSRHLVTHAGVM 595
            ...|.| |:|   |::|.:.|.|.|.|..|..:|.|::
 Frog   503 AEDGIS-TNKHCVCNICGKRFKHPSNLELHKRSHTGIV 539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 18/86 (21%)
C2H2 Zn finger 485..505 CDD:275368 3/20 (15%)
zf-H2C2_2 497..522 CDD:290200 3/25 (12%)
C2H2 Zn finger 513..533 CDD:275368 5/24 (21%)
zf-H2C2_2 526..550 CDD:290200 4/34 (12%)
C2H2 Zn finger 541..562 CDD:275368 2/27 (7%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368
zbtb49NP_001096409.1 BTB 15..118 CDD:279045
BTB 26..118 CDD:197585
zf-C2H2 513..535 CDD:278523 7/22 (32%)
C2H2 Zn finger 515..535 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.