DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb18

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001076421.1 Gene:zbtb18 ZFINID:ZDB-GENE-050419-73 Length:537 Species:Danio rerio

Alignment Length:435 Identity:96/436 (22%)
Similarity:164/436 (38%) Gaps:83/436 (19%)


  Fly   167 RKELAEEVRSEVRKELAEEVRSQVRD-----------------DLRNEVSEDIRKEQLAMLLGEL 214
            :|:|.::..:|......||..|...|                 ||.....||:..::.:      
Zfish   114 KKKLKQKATAEADSTKREEDTSSCSDKVESFSEGGSTGRPATADLLQSDDEDMENKRDS------ 172

  Fly   215 EVYLTEKKAGRWESLDG---SEPETKPQVKEDASPSRSKTKALPKRRPSLVDANL--KATEARKD 274
                .::....|..|..   :.|.|.|:..|...|...|:   |...||....:|  ::..:|:.
Zfish   173 ----PQEPGSMWMRLPSDRTTSPTTSPREAETHGPDAGKS---PAGSPSSSTGSLSRRSAASRRV 230

  Fly   275 AKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGS----DVVHTDNGEIYIIN 335
            :.:.:.:|               .|.:...:....||     |:.|:    ..|..|:.:..::.
Zfish   231 SADTDCVL---------------DLSVKSSLGGGPGE-----NIAGNPYFCSSVTPDSLQSALVQ 275

  Fly   336 SASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNL--GEEISQEQQVFSF 398
            ....:|...|       |:.:.|    .|.|::.||.|.....:....:|  ...:..|..:.:.
Zfish   276 VKVEKDTGSD-------DDELVS----GDYEMEHSGVKEPPSTNGTHLSLVAQRRLGLEAHLSAL 329

  Fly   399 HENVIIVEKEQNDR--DEQTPL---KRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAF 458
            .|..:..|.|::|:  |:.|.:   ...|..|....:.|..|...:.......:.|.|.||...|
Zfish   330 REASLASELERDDKGGDDDTDVLGGDSDRVQEAAGVESSLLPYVSSMLGAPHTQIFMCPLCNKVF 394

  Fly   459 PTQKLLTRHHNTHIK---GLKSGKGGTLKCPSCAL---QLSCASSLKRHMIIHTGLKPFKCSECE 517
            |:..:|..|.:||.:   |:::...|.:..|:|::   ..||..:||||...|:|.||:.|:.|.
Zfish   395 PSPHILQIHLSTHFREQEGVRAKPAGDVNVPTCSICGKTFSCMYTLKRHERTHSGEKPYTCTTCG 459

  Fly   518 LSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVH 562
            .||.....|.||...||..|.|.|..|...|.|..:|.:||.:.|
Zfish   460 KSFQYSHNLSRHAVVHTREKPHACKWCERRFTQSGDLYRHIRKFH 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 17/97 (18%)
RRF <161..222 CDD:294170 11/72 (15%)
zf-C2H2_8 454..530 CDD:292531 28/82 (34%)
C2H2 Zn finger 485..505 CDD:275368 8/23 (35%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
zbtb18NP_001076421.1 BTB 14..110 CDD:279045
BTB 25..110 CDD:197585
C2H2 Zn finger 387..407 CDD:275368 8/20 (40%)
COG5048 <388..>496 CDD:227381 37/108 (34%)
C2H2 Zn finger 427..447 CDD:275368 7/20 (35%)
zf-H2C2_2 440..462 CDD:290200 11/22 (50%)
C2H2 Zn finger 455..475 CDD:275368 7/20 (35%)
C2H2 Zn finger 483..501 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.