DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and bcl6ab

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_005171194.1 Gene:bcl6ab ZFINID:ZDB-GENE-030131-7523 Length:566 Species:Danio rerio

Alignment Length:407 Identity:95/408 (23%)
Similarity:153/408 (38%) Gaps:91/408 (22%)


  Fly   242 EDASPSRSKTKAL------PKRRPSLVDANLKATEARKD---AKEEEFILGCNT----DPANNSD 293
            |..:.:|:.|.|.      .:.|||::..:.:|...||.   :.|.|.|..|:|    .|..:  
Zfish   221 ESGTSARTITNAAVEDGDKERNRPSVLFRSARAEGNRKAPLLSSEVENIEACHTGGPESPLRS-- 283

  Fly   294 VNIDGLELDEEVPAESGEDFREINMVGSDVVH--TDNGEIY---IINSASSEDQNQDSTPEFDQD 353
                  :.....||||....|......|.:.:  ..|.:.|   ::||.    .|...||.....
Zfish   284 ------DCQPNSPAESSGCSRRPASPPSSITYAKVHNWKKYKFIVLNST----DNSSLTPPHTVS 338

  Fly   354 NGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPL 418
            .. |:.|.:..|:...|.:              |.|.:|:...|.|...    .|::........
Zfish   339 ES-TNQNAEHKGQDNRSTD--------------ECIKKEEHGSSVHNTF----TEESSMGSTNSA 384

  Fly   419 KRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTL 483
            :|:|    |:..|......|...:.|. |.::|..|...|            |.||         
Zfish   385 ERER----VYCNECESEAEKPQWLQDG-KPYKCDRCQAMF------------HYKG--------- 423

  Fly   484 KCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCF 548
                        :.|..|..:|||.||::|:.|...|::...||.|...|:|.|.::|..|||.|
Zfish   424 ------------NPLSSHKSVHTGEKPYRCNVCGAQFNRPANLKTHSRIHSGEKPYKCETCSSRF 476

  Fly   549 AQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQ 612
            .|.::|:.|: .:|.| .:.:.|.:|...|.|:..|..||..|.|.. :.|:.|..:|..:|.::
Zfish   477 VQVAHLRAHV-LIHTG-EKPYPCDICGTRFRHLQTLKSHLRIHTGEKPYHCENCDLRFRHKSQLR 539

  Fly   613 RHVTTMH-KVKNKLTDY 628
            .|:...| .:.|....|
Zfish   540 LHLRQKHGAITNTKVQY 556

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 1/2 (50%)
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 18/76 (24%)
C2H2 Zn finger 485..505 CDD:275368 2/20 (10%)
zf-H2C2_2 497..522 CDD:290200 10/25 (40%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 11/24 (46%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
bcl6abXP_005171194.1 BTB 22..126 CDD:279045
BTB 33..128 CDD:197585
C2H2 Zn finger 412..433 CDD:275368 8/54 (15%)
zf-H2C2_2 426..450 CDD:290200 10/24 (42%)
C2H2 Zn finger 441..461 CDD:275368 6/20 (30%)
zf-H2C2_2 453..478 CDD:290200 11/25 (44%)
C2H2 Zn finger 469..489 CDD:275368 8/21 (38%)
zf-H2C2_2 481..506 CDD:290200 7/27 (26%)
C2H2 Zn finger 497..517 CDD:275368 7/20 (35%)
zf-H2C2_2 510..534 CDD:290200 8/24 (33%)
C2H2 Zn finger 525..543 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.