DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and notch1b

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:XP_005168706.1 Gene:notch1b ZFINID:ZDB-GENE-990415-183 Length:2482 Species:Danio rerio

Alignment Length:477 Identity:86/478 (18%)
Similarity:140/478 (29%) Gaps:195/478 (41%)


  Fly   143 CLRVPDACRGRLWA---------------LTKIP----GSTLVY--------------------H 168
            |.:|.|.|:|:...               :.|.|    |||..|                    .
Zfish  1298 CDKVFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGSTCEYDAHACGSLQCKNGGTCVSGHK 1362

  Fly   169 SKKTIST-LVTRRECAE---------------RCFFETQ---FRCLSASFAPSYRNN------RE 208
            |.|.:.| ..|..||.:               .|.:.|:   :.|:    .|:..|.      ..
Zfish  1363 SPKCLCTPAFTGPECQDPSGGHCTTNPCYNGGTCEYITEEPYYHCI----CPTNFNGLFCHILDW 1423

  Fly   209 RFRGEAGPGQRPSPRLG------RCMLSDRDKTVQPDAFRAAPYDEEYMENQCHERAIESD---- 263
            .|.|..|....|:|::.      :|.:...:|               ..::.|:..|.:.|    
Zfish  1424 SFPGGTGQDITPAPKVSVSCEIEQCKVKKGNK---------------ICDSACNNYACDWDGGDC 1473

  Fly   264 ---------NCSYEL----YANSSFIYAEAR-----YLGLSQKECQAMCS---------HEAKFY 301
                     |||..|    |.|:.....:..     |.|...:..:|.|:         |.|..|
Zfish  1474 SLNFNDPWKNCSAALQCWRYFNNGKCDEQCHNTGCLYDGFDCQRVEAQCNPLYDQYCKDHFADGY 1538

  Fly   302 C-QGVSFYYVNQLSLSECLLHSEDIVSLGPRSL--------------KLRENSV-YMRRV-KCLD 349
            | ||        .:.:||.....|..:..|..|              :||.||. ::|.: :.|.
Zfish  1539 CDQG--------CNNAECEWDGLDCANDTPEKLAAGLLVVVVHIHPDQLRNNSFGFLRELSRVLH 1595

  Fly   350 VRVFCTRD----EMTIKYNPKDWFVGK----------------IYASMHSK--DCLARGSGNGSV 392
            ..|...||    ||...|...:..:.|                :.:||.:.  :.:..|......
Zfish  1596 TNVVFRRDSKGQEMIYPYYGNEQELKKHNIKRSLDGWNDASSDVLSSMKNSIYNIVVEGGRKRRE 1660

  Fly   393 LLTLQI-GS----EVKENRCGILRAYEMTQEYQRTFISALVVIQNNPNVQTQGDRLIKVGCIQSN 452
            |..:|: ||    |:...:|     |:.|.|.                .|:..|....:|.:.|:
Zfish  1661 LEKIQVKGSVVYLEIDNRQC-----YQQTSEC----------------FQSANDAAAFLGALASS 1704

  Fly   453 ATTSLG--VSVRDSSVDSSEPV 472
            .:..:.  :....|.:|...||
Zfish  1705 GSLKMPYVIEAVTSEIDGPSPV 1726

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 24/151 (16%)
PAN_AP_HGF 270..344 CDD:238532 22/104 (21%)
notch1bXP_005168706.1 EGF_CA 175..213 CDD:238011
EGF_CA 221..252 CDD:238011
EGF_CA 254..290 CDD:238011
EGF_CA 292..329 CDD:238011
EGF_CA 332..367 CDD:238011
EGF_CA 409..447 CDD:238011
EGF_CA 449..485 CDD:238011
EGF_CA 487..523 CDD:238011
EGF_CA 525..561 CDD:238011
EGF_CA 563..598 CDD:238011
EGF_CA 600..636 CDD:238011
EGF_CA 638..672 CDD:238011
EGF_CA 675..711 CDD:238011
EGF_CA 715..747 CDD:238011
EGF_CA 752..786 CDD:238011
EGF_CA 788..824 CDD:238011
EGF_CA 866..902 CDD:238011
EGF_CA 904..940 CDD:238011
EGF_CA 942..978 CDD:238011
EGF_CA 985..1016 CDD:238011
EGF_CA 1018..1054 CDD:238011
EGF 1060..1090 CDD:278437
EGF_CA 1143..1177 CDD:238011
EGF_CA 1181..1216 CDD:238011
EGF_CA 1218..1262 CDD:238011
EGF_CA 1264..1298 CDD:238011 86/478 (18%)
EGF_CA <1309..1340 CDD:238011 5/31 (16%)
NL 1437..1473 CDD:197463 6/51 (12%)
Notch 1481..1516 CDD:278494 8/35 (23%)
NL 1515..1555 CDD:197463 11/48 (23%)
NOD 1561..1612 CDD:284282 12/51 (24%)
NODP 1667..1724 CDD:284987 13/78 (17%)
Ank_2 <1867..1953 CDD:289560
ANK repeat 1874..1920 CDD:293786
ANK 1917..2029 CDD:238125
ANK repeat 1922..1953 CDD:293786
Ank_2 1927..2020 CDD:289560
ANK repeat 1955..1986 CDD:293786
ANK 1984..2108 CDD:238125
ANK repeat 1989..2053 CDD:293786
Ank_2 1994..2086 CDD:289560
ANK repeat 2055..2086 CDD:293786
DUF3454 2404..2467 CDD:288764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.