DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and nell2a

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001073544.1 Gene:nell2a ZFINID:ZDB-GENE-030131-7972 Length:811 Species:Danio rerio

Alignment Length:377 Identity:80/378 (21%)
Similarity:123/378 (33%) Gaps:124/378 (33%)


  Fly    89 RICNEDPDCIAYVHLLDTDECHG--------YSYFERTSRYLAISGELPLVADGEAVFYEKTCLR 145
            |.|   |.|         ::.||        .....:||..|:::.|  .::..::.:.|:|| |
Zfish   223 RTC---PTC---------NDFHGLVQKIMELQDILAKTSSKLSLAEE--KMSGLDSCYCERTC-R 272

  Fly   146 VPD----------------ACRGRLWALTKI--------PGSTLVYHSKKTISTLVTRRECAERC 186
            |.|                .|........||        .|:|..|      .|....:||...|
Zfish   273 VKDQIYREEQSWTDGCKNCTCSNGTVRCEKILCPPLDCPDGTTPAY------VTGTCCKECQPMC 331

  Fly   187 FFETQFRCLSASFAPSYRNNRERFRGEAGPGQRPSPRLGRCMLSD-RDKTVQP-------DAFRA 243
            .|..|                ....|::.....||   |.|.|.. ||:|:..       .|...
Zfish   332 LFSEQ----------------TLVEGQSCAVHHPS---GLCQLFQCRDRTMHRVPGAEDCPALSC 377

  Fly   244 APYDEEYMENQC------HERAIESDNCSYELYANSSFIYAEA----------RYLGLSQKECQA 292
            |..|:..:.::|      |:...|.:.||    .||..:..:|          |.|.|....|:.
Zfish   378 AESDQITLTDRCCRVCRGHDFCAEENICS----ENSDCVNLDAGASCGCKNGFRPLRLDSAYCED 438

  Fly   293 M--CSHEAKFYCQGVSFYYVNQLSLSECLLHSEDIVSLGPRSLKLRENSVYMRRVKCLDVRVFCT 355
            :  |: |.:.||: .:...||......|:.|:..|        ::.:.|. ....:|...:..| 
Zfish   439 IDECA-EGRHYCR-ENTECVNTAGSFMCVCHTGFI--------RIDDYSC-TEHDECASGQHDC- 491

  Fly   356 RDEMTIKYNPKDWFVGKIYASMHSKDCLARGSGNGSVLLTLQIGSEVKENRC 407
             ||..:.:|.    ||.     ||..|....||||:|...|..|..:....|
Zfish   492 -DENALCFNT----VGG-----HSCSCKPGYSGNGTVCRALCDGRCLNGGSC 533

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 23/112 (21%)
PAN_AP_HGF 270..344 CDD:238532 17/86 (20%)
nell2aNP_001073544.1 LamG 40..211 CDD:304605
VWC 271..327 CDD:302663 12/63 (19%)
EGF_CA 438..>470 CDD:284955 8/34 (24%)
EGF_3 484..519 CDD:289699 15/46 (33%)
EGF_CA 553..587 CDD:214542
EGF_CA 600..>631 CDD:284955
VWC 638..690 CDD:302663
VWC 707..753 CDD:302663
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.