DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and notch3

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_571624.2 Gene:notch3 ZFINID:ZDB-GENE-000329-5 Length:2468 Species:Danio rerio

Alignment Length:426 Identity:78/427 (18%)
Similarity:134/427 (31%) Gaps:129/427 (30%)


  Fly   186 CFFETQFRCLSASFAPSYRNNR-ERFRGEAGPGQRPSPRLGRCMLSDRDKTVQPDAFRAAPYDEE 249
            |..||.:..........::..| |:..|.:.|  .|||    |.::        |.|..|  ::.
Zfish  1356 CTEETSYPFFHCQCTNGWKGKRCEQKTGSSAP--LPSP----CPIA--------DCFSKA--NDG 1404

  Fly   250 YMENQCHERAIESDNCSYELYANSSFIYAEARYLGL-SQKECQAMCSH-EAKF------------ 300
            ..:.:|:......|.....|..|.....|:.|...| :..:|...|:: |..|            
Zfish  1405 VCDKECNSLDCRWDGGDCSLAVNPWARCADPRCWRLFNNSQCDEFCNNAECLFDNFDCINKEKVC 1469

  Fly   301 ------YCQGVSFYYVNQLSLSECLLH-----------------SED----IVSLGPRSLKLREN 338
                  ||   :.:|.:.|....|...                 :||    :|.|.|..| ||..
Zfish  1470 NPIYEAYC---TDHYADGLCDQGCNTEECGWDGLDCARKIPEDLAEDMLVIVVLLPPEEL-LRTQ 1530

  Fly   339 SVYMRRVKC---------LD------VRVFCTRDEMTIK--YNPKDWFVGKIY-------ASMHS 379
            :.:::::..         ||      :|.:..| |..||  .||::.....:|       .|..|
Zfish  1531 TAFLQKLSAILRTTLRFRLDRNGDYMIRPYTGR-ETRIKRELNPQEVIGSIVYLEIDNRLCSQGS 1594

  Fly   380 KDCLARGSGNGSVLLTLQIGSEVKENRCGILRAYEMTQ-EYQRTFISALVVIQNNPNVQ--TQGD 441
            .||..........|              |.|.|.||.: .|.   |..:...:..|::.  .:..
Zfish  1595 DDCFRNADSAAEYL--------------GALSAREMLRFPYP---IKEVTSEKREPSITEIPEWA 1642

  Fly   442 RLIKVGCIQSNATTSLGVSVRDSSVDSSEPVPSAIALESSLEYTEHMFPHEGVVHYNSSTGPHPH 506
            ||:.||.........|.|.:              :......|::...||....:...:|:..:..
Zfish  1643 RLLLVGVASLFLLVILMVGM--------------LIARRKREHSTLWFPEGFFLKKETSSNKNRR 1693

  Fly   507 PSISLQILDLSHQHETNDVQIGQNLELQIVAEYSPQ 542
            ..:....|.:.|..:|        :|..::|::|.|
Zfish  1694 EPVGQDSLGMKHMPKT--------VEESLLADHSDQ 1721

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 14/70 (20%)
PAN_AP_HGF 270..344 CDD:238532 21/115 (18%)
notch3NP_571624.2 EGF_CA 97..131 CDD:238011
EGF_CA 134..171 CDD:238011
EGF_CA 212..247 CDD:238011
EGF_CA 250..287 CDD:238011
EGF_CA 290..325 CDD:238011
EGF_CA 367..405 CDD:238011
EGF_CA 407..443 CDD:238011
EGF_CA 445..481 CDD:238011
EGF_CA 483..519 CDD:238011
EGF_CA 521..556 CDD:238011
EGF_CA 560..594 CDD:238011
EGF_CA 596..631 CDD:238011
EGF_CA 634..668 CDD:238011
EGF_CA 672..705 CDD:238011
EGF_CA 708..744 CDD:238011
EGF_CA 746..781 CDD:238011
EGF_CA 824..860 CDD:238011
EGF_CA 862..897 CDD:238011
EGF_CA 902..936 CDD:238011
EGF_CA 938..974 CDD:238011
EGF_CA 977..1012 CDD:238011
EGF_CA 1015..1050 CDD:238011
EGF_CA 1103..1137 CDD:238011
EGF_CA 1140..1175 CDD:238011
EGF_CA <1193..1220 CDD:238011
EGF_CA 1222..1260 CDD:238011
Notch 1392..1423 CDD:278494 6/41 (15%)
Notch 1429..1462 CDD:278494 7/33 (21%)
Notch 1475..1502 CDD:278494 5/30 (17%)
NOD 1508..1559 CDD:284282 11/52 (21%)
NODP 1577..1634 CDD:284987 14/74 (19%)
ANKYR <1784..1896 CDD:223738
ANK <1784..1895 CDD:238125
ANK repeat 1791..1839 CDD:293786
ANK repeat 1841..1872 CDD:293786
Ank_5 1861..1916 CDD:290568
ANK 1869..1995 CDD:238125
ANK repeat 1875..1906 CDD:293786
ANK repeat 1908..1939 CDD:293786
Ank_2 1913..2005 CDD:289560
ANK 1936..2057 CDD:238125
ANK repeat 1941..1972 CDD:293786
ANK repeat 1974..2005 CDD:293786
Ank_2 1979..>2039 CDD:289560
Amelogenin 2232..2325 CDD:197891
DUF3454 2384..2445 CDD:288764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.