DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and notch2

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001108566.2 Gene:notch2 ZFINID:ZDB-GENE-000329-4 Length:2475 Species:Danio rerio

Alignment Length:273 Identity:52/274 (19%)
Similarity:92/274 (34%) Gaps:86/274 (31%)


  Fly   357 DEMTIKYNPKDWFVGKIYASMHS-KDCLARGSGNGSV---------LLTLQIGSEVKENRCGILR 411
            ||..:.::|            || .:.:..|.|:.|:         :|.::.|.:.|:||....:
Zfish  2065 DEYNLVHSP------------HSGPNHVGNGGGHSSMVCGTNGTGYILGMRPGPQGKKNRRAGGK 2117

  Fly   412 AYEMTQEYQRTFISALVVIQNNPN---------VQTQGDRLIKV--GCIQSNATTS--------- 456
            |..:.....:.........:..|.         |.|.|..:.:.  |..:|:.|.|         
Zfish  2118 ANGVAAGTAKDLKEMKAKRRKKPTGGEGPSVVPVTTAGGNVSRAAGGLSESSVTMSPVDSLESPH 2182

  Fly   457 --LGVSVRDSSVDSSEPVPSAIALESSL-------------------EYTEHMF---PHEGVVHY 497
              .|..|..||..:|.|:.|:.:....|                   .|..|||   ||..:...
Zfish  2183 SYAGEPVATSSTANSPPLLSSQSARPMLPPVSHMLGQQQSWVGLSKHSYNGHMFSLMPHHQMSAG 2247

  Fly   498 NSSTGPHPHPSISLQI-LDLSHQH-------ETNDVQIGQNL-------ELQIVAEYSPQQLAEH 547
            :|....|..|.:|..: :.:|.:.       :......||:|       ::|...:..||  |:|
Zfish  2248 HSGMQQHHSPGMSAPMNVTMSREQLPPIVTFQMMPTGSGQSLLKQPQQGQMQAQGQNQPQ--AQH 2310

  Fly   548 MEL---QLAPLPD 557
            :..   .:.|:||
Zfish  2311 LHCSQGMMYPIPD 2323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532
notch2NP_001108566.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.