DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and Notch3

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_064472.2 Gene:Notch3 RGDID:620761 Length:2319 Species:Rattus norvegicus

Alignment Length:352 Identity:76/353 (22%)
Similarity:128/353 (36%) Gaps:89/353 (25%)


  Fly    87 CWRICNE---DPDCIAYVHLLDTDECHGYSYFERTSRYLAISGELPLVADGEAVFYEKTCL---- 144
            |||:.|.   ||.|.:...|.|..:|:.... :||..        |:        |:|.|.    
  Rat  1435 CWRLFNNSRCDPACSSPACLYDNFDCYSGGR-DRTCN--------PV--------YKKYCADHFA 1482

  Fly   145 --RVPDACRGR------LWALTKIPGSTLVYHSKKTISTLVTRREC--AERCFFETQFRCLSASF 199
              |....|...      |...:::|  .|:......::.|:...|.  :...|.:.    |||..
  Rat  1483 DGRCDQGCNTEECGWDGLDCASEVP--ALLARGVLVLTVLLPPEELLRSSADFLQR----LSAIL 1541

  Fly   200 APSYRNNRERFRGEA--GPGQRPSP----RLGRCMLSDRDKTVQPDAFRAAPYDEEYMENQCHER 258
            ..|.|...:. ||:|  .|..||||    |:.|        .:.|:...:....|  ::|:...:
  Rat  1542 RTSLRFRLDA-RGQAMVFPYHRPSPGSESRVRR--------ELGPEVIGSVVMLE--IDNRLCLK 1595

  Fly   259 AIESDNCSYELYANSSFIYAEARYLG-LSQKECQAMCSHEAKFYCQGVSFYYVNQLSLSECLLHS 322
            :.|:|:|..:  |.|:     |.||| ||..|              .:.|.|..:....|.|...
  Rat  1596 SAENDHCFPD--AQSA-----ADYLGALSAVE--------------RLDFPYPLRDVRGEPLEPP 1639

  Fly   323 EDIVSLGPRSLKLRENSVYMRRVKCLDVRVFCTRDEMTIKYNPKDWFVGKIYASMH-------SK 380
            |..|.|.|   .|...:|::..:..|.|.|...:.|.:..:.|:.:.:.|..|:.|       .:
  Rat  1640 EQSVPLLP---LLVAGAVFLLVIFVLGVMVARRKREHSTLWFPEGFALHKDIAAGHKGRREPVGQ 1701

  Fly   381 DCLARGSGNGSVLLTLQIGSEVKENRC 407
            |.|...:......|..::.::..::.|
  Rat  1702 DALGMKNMTKGESLMGEVATDWNDSEC 1728

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 23/104 (22%)
PAN_AP_HGF 270..344 CDD:238532 19/75 (25%)
Notch3NP_064472.2 ANKYR <1779..1895 CDD:223738
ANK <1781..1894 CDD:238125
ANK repeat 1790..1838 CDD:293786
ANK repeat 1840..1871 CDD:293786
ANK 1 1840..1869
Ank_5 1860..1915 CDD:290568
ANK 1868..1994 CDD:238125
ANK repeat 1873..1905 CDD:293786
ANK 2 1873..1903
ANK repeat 1907..1938 CDD:293786
ANK 3 1907..1936
Ank_2 1912..2004 CDD:289560
ANK repeat 1940..1971 CDD:293786
ANK 4 1940..1969
ANK repeat 1973..2004 CDD:293786
ANK 5 1973..2002
DUF3454 2213..2269 CDD:288764
EGF_CA 160..197 CDD:238011
EGF_CA 238..274 CDD:238011
EGF_CA 276..313 CDD:238011
EGF_CA 316..351 CDD:238011
EGF_CA 393..431 CDD:238011
EGF_CA 433..469 CDD:238011
EGF_CA 471..507 CDD:238011
EGF_CA 509..545 CDD:238011
EGF_CA 547..582 CDD:238011
EGF_CA 585..620 CDD:238011
EGF_CA 622..656 CDD:238011
EGF_CA 660..>688 CDD:238011
EGF_CA 698..731 CDD:238011
EGF_CA 738..772 CDD:238011
EGF_CA 812..848 CDD:238011
EGF_CA 851..886 CDD:238011
EGF_CA 889..924 CDD:238011
EGF_CA 931..962 CDD:238011
EGF_CA 965..1000 CDD:238011
EGF_CA 1087..1122 CDD:238011
EGF_CA 1124..1160 CDD:238011
EGF_CA 1173..1205 CDD:238011
NL 1382..1419 CDD:197463
LNR 1 1389..1429
NL 1423..1460 CDD:197463 9/25 (36%)
LNR 2 1430..1467 10/33 (30%)
LNR 3 1469..1507 7/54 (13%)
Notch 1476..1502 CDD:278494 4/26 (15%)
NOD 1510..1559 CDD:284282 11/54 (20%)
NODP 1580..1639 CDD:284987 18/82 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.